BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j05 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4492| Best HMM Match : PPI_Ypi1 (HMM E-Value=3.8) 30 2.0 SB_42582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 28 8.1 >SB_4492| Best HMM Match : PPI_Ypi1 (HMM E-Value=3.8) Length = 276 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 556 SYAIENRKSFENKPVFKE 609 S+A+ NR FENKP FK+ Sbjct: 79 SFALRNRHDFENKPFFKD 96 >SB_42582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 939 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 523 IIFSDGNCSSLSYA-IENRKSFENKPVFKET 612 IIFSD NC ++++ I NRK +N + T Sbjct: 783 IIFSDKNCKTMAFRDIHNRKILKNHTTYNIT 813 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 27.9 bits (59), Expect = 8.1 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = +1 Query: 151 IDIET*RTMAKFH-NYYVLCPLIDQKSFLGVSKDKEDANVLVTLG-RNVVNKYRLSDQKQ 324 IDI T ++ FH N YV C V D NV +T G RN + + + + Sbjct: 275 IDIHTGCQVSLFHQNDYVTC----------VQYHPIDRNVFLTGGARNGIKSWDIRTGNE 324 Query: 325 VGGWTS-KDHITSAVIYDDTNGNYIGVFN 408 TS K H + +NGNY+ +F+ Sbjct: 325 AFTCTSLKVHPSGCQFIAQSNGNYLAIFS 353 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,875,314 Number of Sequences: 59808 Number of extensions: 399185 Number of successful extensions: 976 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -