BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j03 (546 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 25 0.66 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 24 1.2 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 24.6 bits (51), Expect = 0.66 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 211 KSQNLILKTETPINIELTNTKQFPKSANKVN 303 K+QNL + N+ NTKQF + + N Sbjct: 258 KTQNLYYSAMSSHNLNYVNTKQFTQGKFQAN 288 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 214 SQNLILKTETPINIELTNTKQFPKSANKVN 303 +QNL + N+ NT+QF KS + N Sbjct: 260 TQNLYYSALSSHNLNYVNTEQFVKSQYQAN 289 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,026 Number of Sequences: 438 Number of extensions: 1853 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -