BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10i20 (479 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 23 1.5 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 22 3.4 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 203 APSTGGVKKPHRYRPGTVALREI 271 AP+T G+ P PG + EI Sbjct: 265 APATTGIAGPFTQSPGVLGFNEI 287 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.8 bits (44), Expect = 3.4 Identities = 15/62 (24%), Positives = 26/62 (41%) Frame = +2 Query: 125 TKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLI 304 T+ + R S+G ++PR + K K T K+P G R + ++ L Sbjct: 197 TRYSDRPSSG-RSPRTRRVKKPGAKQGAPTAEEKRPRTAFSGAQLARLKHEFAENRYLTE 255 Query: 305 RK 310 R+ Sbjct: 256 RR 257 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,861 Number of Sequences: 336 Number of extensions: 1920 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -