BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10i16 (544 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_48284| Best HMM Match : HIG_1_N (HMM E-Value=5.6e-25) 54 6e-08 SB_33010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_16257| Best HMM Match : rve (HMM E-Value=1.1e-13) 27 7.5 SB_4451| Best HMM Match : Cornifin (HMM E-Value=0.11) 27 7.5 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 82.6 bits (195), Expect = 2e-16 Identities = 40/70 (57%), Positives = 46/70 (65%) Frame = +2 Query: 245 ETTREKFHRKFTENPFVPLGCLATAGALSMGLWSFRTGKTRLSQQMMRVRILAQGLTIAA 424 ETT+EKF RK ENPFVP+GC T AL GL SF+ G + Q MMR R++AQG TI A Sbjct: 3092 ETTKEKFARKVKENPFVPIGCALTVSALVYGLLSFKRGDVGMQQTMMRARVVAQGSTIVA 3151 Query: 425 LVIGVVITTG 454 LV G T G Sbjct: 3152 LVGGCFATAG 3161 Score = 58.0 bits (134), Expect = 5e-09 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +2 Query: 302 GCLATAGALSMGLWSFRTGKTRLSQQMMRVRILAQGLTIAALVIGVVIT 448 GC ATAGAL GL SF+ G ++ QQMMR R+LAQG T+ A++ G+ T Sbjct: 3155 GCFATAGALVYGLLSFKRGNQKVQQQMMRARVLAQGSTLIAVIGGLGYT 3203 >SB_48284| Best HMM Match : HIG_1_N (HMM E-Value=5.6e-25) Length = 103 Score = 54.4 bits (125), Expect = 6e-08 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 209 QLRKEMGASHHVETTREKFHRKFTENPFVPLGCLATAGALSMGLWSFR-TGKTRLSQQMM 385 QL + ET EK RK PF+P+G L T A+ G+ ++R G S+ +M Sbjct: 9 QLSESWQTREERETETEKLIRKSKAQPFIPIGILGTTAAIVWGVIAYRHRGPMSTSRYIM 68 Query: 386 RVRILAQGLTIAALVIGVVIT 448 R+R++AQ + ++++G+ IT Sbjct: 69 RLRVIAQSCVVGSIMVGMGIT 89 >SB_33010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +1 Query: 256 RKIS*KIYRESVCSSRLFSNSWSFIHGSLEF*NWKDKTLSANDESENSCT 405 R+I ++ RES C + + SW+ I ++ N D + A + +C+ Sbjct: 31 REIKREVRRESTCLTPIIFCSWTIIQNNVVIRNQSDPSSPATSTTTITCS 80 >SB_16257| Best HMM Match : rve (HMM E-Value=1.1e-13) Length = 353 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 200 HWVQLRKEMGASHHVETTREKFHRKFTENPF 292 HWV++R+ H + E FHR + F Sbjct: 265 HWVEVRRAEPGHHRSQAFAESFHRWLAQRLF 295 >SB_4451| Best HMM Match : Cornifin (HMM E-Value=0.11) Length = 1384 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 451 CGDYYTNN*SSNGKPLCKNSHSHHLLRESCLSSSKTPKTHG 329 CG+ + ++ S+ KP C N HH +S K HG Sbjct: 761 CGNRFKHHGGSHSKPYCGNRFKHHGGSDSKSYCGNRFKHHG 801 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 451 CGDYYTNN*SSNGKPLCKNSHSHHLLRESCLSSSKTP 341 CG+ + ++ S+ KP C N HH+ + + TP Sbjct: 809 CGNRFRHHGGSDSKPYCGNRFRHHVTPTLNYTVAATP 845 Score = 27.1 bits (57), Expect = 9.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 451 CGDYYTNN*SSNGKPLCKNSHSHH 380 CG+ + ++ S+ KP C N HH Sbjct: 665 CGNRFRHHGGSHSKPYCGNRFKHH 688 Score = 27.1 bits (57), Expect = 9.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 451 CGDYYTNN*SSNGKPLCKNSHSHH 380 CG+ + ++ S+ KP C N HH Sbjct: 729 CGNRFKHHGGSDSKPYCGNRFKHH 752 Score = 27.1 bits (57), Expect = 9.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 451 CGDYYTNN*SSNGKPLCKNSHSHH 380 CG+ + ++ S+ KP C N HH Sbjct: 745 CGNRFKHHGGSHSKPYCGNRFKHH 768 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,093,020 Number of Sequences: 59808 Number of extensions: 285824 Number of successful extensions: 629 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -