BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10i07 (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding pr... 29 0.12 AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding pr... 29 0.12 AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding pr... 28 0.29 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 28 0.29 AJ618921-1|CAF02000.1| 172|Anopheles gambiae putative odorant-b... 28 0.29 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 2.0 >AY330177-1|AAQ16283.1| 166|Anopheles gambiae odorant-binding protein AgamOBP50 protein. Length = 166 Score = 29.1 bits (62), Expect = 0.12 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 522 CSFDCSFSDLW*KCGNDSHRAEQIHMNRAFY 430 C+FDC++ ++ G D EQI N+A Y Sbjct: 61 CAFDCTYREMGILTGVDDINVEQISTNQAGY 91 >AJ618926-1|CAF02005.1| 315|Anopheles gambiae odorant-binding protein OBPjj6b protein. Length = 315 Score = 29.1 bits (62), Expect = 0.12 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 522 CSFDCSFSDLW*KCGNDSHRAEQIHMNRAFY 430 C+FDC++ ++ G D EQI N+A Y Sbjct: 210 CAFDCTYREMGILTGVDDINVEQISTNQAGY 240 >AY330178-1|AAQ16284.1| 176|Anopheles gambiae odorant-binding protein AgamOBP51 protein. Length = 176 Score = 27.9 bits (59), Expect = 0.29 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 564 TMATNVDYTGLRF-ACSFDCSFSDLW*KCGNDSHRAEQIHMNRAFY 430 TMA + L + C DC++ ++ G D EQI N+A Y Sbjct: 56 TMAEKYPNSTLDYLVCGLDCTYREMGILTGVDDINVEQISTNQAVY 101 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 27.9 bits (59), Expect = 0.29 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 564 TMATNVDYTGLRF-ACSFDCSFSDLW*KCGNDSHRAEQIHMNRAFY 430 TMA + L + C DC++ ++ G D EQI N+A Y Sbjct: 58 TMAEKYPNSTLDYLVCGLDCTYREMGILTGVDDINVEQISTNQAVY 103 >AJ618921-1|CAF02000.1| 172|Anopheles gambiae putative odorant-binding protein OBP5479 protein. Length = 172 Score = 27.9 bits (59), Expect = 0.29 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 564 TMATNVDYTGLRF-ACSFDCSFSDLW*KCGNDSHRAEQIHMNRAFY 430 TMA + L + C DC++ ++ G D EQI N+A Y Sbjct: 58 TMAEKYPNSTLDYLVCGLDCTYREMGILTGVDDINVEQISTNQAVY 103 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 496 IRKTAIETTSKPKPRIINVGSHCGLQPLPAF 588 IRK+ KP+ +I VG GL P F Sbjct: 515 IRKSQFRLPPKPETPVIMVGPGTGLAPFRGF 545 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,572 Number of Sequences: 2352 Number of extensions: 12505 Number of successful extensions: 24 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -