BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10i06 (491 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 3.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 22 9.9 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 22 9.9 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 3.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 149 PHPEVFKPRRXXXXXXXXXXAYVYLYF 229 P PE F P R AYVY+ F Sbjct: 419 PDPERFDPERFRPEVANARPAYVYMPF 445 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 22.2 bits (45), Expect = 9.9 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +3 Query: 192 YYYIFKPTYIYIFNYIINK 248 Y + P Y+F+Y++N+ Sbjct: 98 YIFFRMPPIYYLFDYVVNE 116 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 22.2 bits (45), Expect = 9.9 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 114 YLAL*KRPVLRILILKSSSLGGFFKLYYYIFKPTYIYIFN 233 +LAL V+ +L++++ +L G Y KP + I++ Sbjct: 284 FLALFPYVVMAVLLVRACTLPGAVDGIVYFLKPQWDKIYD 323 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 402,424 Number of Sequences: 2352 Number of extensions: 7692 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -