BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10i02 (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 6.9 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.1 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 6.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 186 RSGEHSGLTSTISS**VSNG*NFKLYILTLNSRQIRQTVSLPI 58 RS E ++S ++ +N N KLY +N QI V +PI Sbjct: 308 RSREPKIISSLSNNTIHNNNYNKKLYYNIINIEQIPVPVPVPI 350 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 467 SLEINETNSEDYCNIEYLS 523 SL+ TN +DY + YL+ Sbjct: 364 SLDNTNTNDQDYSSQNYLT 382 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,150 Number of Sequences: 438 Number of extensions: 3262 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -