BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10i02 (594 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g48195.1 68416.m05258 phox (PX) domain-containing protein con... 31 0.44 At2g14140.1 68415.m01575 hypothetical protein similar to At2g049... 31 0.58 At3g11080.1 68416.m01339 disease resistance family protein conta... 31 0.77 At5g27650.1 68418.m03313 PWWP domain-containing protein hypothet... 30 1.0 At1g63580.1 68414.m07187 protein kinase-related 30 1.3 At5g28960.1 68418.m03583 hypothetical protein 29 1.8 At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptid... 29 1.8 At3g28110.1 68416.m03508 hypothetical protein 29 1.8 At4g31160.1 68417.m04423 transducin family protein / WD-40 repea... 29 2.3 At3g17170.1 68416.m02190 ribosomal protein S6 family protein (RF... 29 2.3 At5g43720.1 68418.m05345 expressed protein 29 3.1 At5g42540.1 68418.m05178 5'-3' exoribonuclease (XRN2) identical ... 28 4.1 At3g59410.1 68416.m06626 protein kinase family protein low simil... 28 4.1 At1g26960.1 68414.m03287 homeobox-leucine zipper protein, putati... 28 4.1 At4g22370.1 68417.m03233 hypothetical protein 28 5.4 At5g64840.1 68418.m08157 ABC transporter family protein 27 7.1 At5g23890.1 68418.m02806 expressed protein weak similarity to SP... 27 7.1 At2g42700.1 68415.m05287 expressed protein 27 7.1 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 27 7.1 At4g18240.1 68417.m02709 starch synthase-related protein contain... 27 9.4 At3g47270.1 68416.m05135 hypothetical protein similar to At2g049... 27 9.4 At3g30450.1 68416.m03852 hypothetical protein similar to At2g049... 27 9.4 At3g03200.1 68416.m00316 no apical meristem (NAM) family protein... 27 9.4 At2g04970.1 68415.m00518 hypothetical protein similar to At2g152... 27 9.4 At1g69770.1 68414.m08028 chromomethylase 3 (CMT3) nearly identic... 27 9.4 >At3g48195.1 68416.m05258 phox (PX) domain-containing protein contains Pfam profile PF00787: PX domain Length = 938 Score = 31.5 bits (68), Expect = 0.44 Identities = 20/63 (31%), Positives = 30/63 (47%) Frame = +2 Query: 374 DVTPTDLFHNDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDEDYSDLQSQ 553 D+TPT+L DS D+ D + + +E S + ++N C E L SD+ S Sbjct: 324 DITPTELGIEDSSGGVCDLDDDVSSGLLHESSEDGKQSNPFGECTSEPLLASQNSDMPSS 383 Query: 554 LDS 562 DS Sbjct: 384 RDS 386 >At2g14140.1 68415.m01575 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At3g30450, At4g03990, At5g34895, At3g47270, At2g02200 Length = 847 Score = 31.1 bits (67), Expect = 0.58 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 2/94 (2%) Frame = +2 Query: 254 LVAQSLFYKILKSGKKVNI--ESVKSLDKHYLKKSLTIYTETDVTPTDLFHNDSPTEYLD 427 +V QS K + G+KV + E+ + L K + L Y + P + D TE + Sbjct: 370 VVHQSRKRKSMSFGEKVKLVYENCEVLKKKVGR--LEGYLGIERVPAIEYRGDEGTEKQE 427 Query: 428 IPADDNIIIENEDSLEINETNSEDYCNIEYLSDE 529 IP + +E E+ + E E+ +EY DE Sbjct: 428 IPKQGDEEMEGEEEKQEEEGKEEEEEKVEYRGDE 461 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 395 FHNDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDE 529 + D TE +IP + +E E+ + E E+ +EY DE Sbjct: 497 YRGDEETEKQEIPKQGDEEMEGEEEKQEEEGKEEEEEKVEYRGDE 541 >At3g11080.1 68416.m01339 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 943 Score = 30.7 bits (66), Expect = 0.77 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 407 SPTEYLDIPADDNIIIENEDSLEINETNSEDYC 505 +PT +L +P + ++E ++ EI + +S DYC Sbjct: 32 APTRHLCLPEQRDALLELKNEFEIGKPSSNDYC 64 >At5g27650.1 68418.m03313 PWWP domain-containing protein hypothetical protein F22F7.12 - Arabidopsis thaliana, EMBL:AC009606 Length = 1072 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = +2 Query: 425 DIPADDNIIIENEDSLEINETNSEDYCNIEYLSDEDYSDLQSQLDSKELSL 577 +I ++D +I ++++S E+ E E E SD+ S+L S+ D KEL L Sbjct: 86 EIKSEDVLIDKDDESSEVKEEEEE-----EDGSDDQSSELGSEADEKELDL 131 >At1g63580.1 68414.m07187 protein kinase-related Length = 273 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 155 VEVNPECSPDLPQCVCYLCAGL-LKKYSRFKSKCLVAQSLFYKIL 286 +E +CSPDL C +C GL ++K+S S+ A+ F K L Sbjct: 189 LEAMAQCSPDLDPSSCTVCLGLVVEKFSECCSQSRWARIHFPKCL 233 >At5g28960.1 68418.m03583 hypothetical protein Length = 457 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +2 Query: 401 NDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSD-EDYSDLQSQLDSK 565 ND + L + A DN+++ NED L+ N D N +L + E S ++ +LD++ Sbjct: 16 NDDQVKLL-VSAWDNLVLNNEDFLKKLGMNKSDVPNAPHLENCEVISRVRERLDTR 70 >At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptidyl-prolyl cis-trans isomerase-related immunophilin FKBP46 - Spodoptera frugiperda (fall armyworm),PIR2:A55320 Length = 477 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/66 (27%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = +2 Query: 368 ETDVTPTDLFHNDSPTEYLDIPADDNIIIENE-DSLEINETNSEDYCNIEYLSDEDYSDL 544 E VT H EY DD E++ D +++ E+ +D C + DE + Sbjct: 80 EFTVTGDRSIHLSGFLEYYQDDEDDYEHDEDDSDGIDVGESEEDDSCEYDSEEDEQLDEF 139 Query: 545 QSQLDS 562 + LDS Sbjct: 140 EDFLDS 145 >At3g28110.1 68416.m03508 hypothetical protein Length = 354 Score = 29.5 bits (63), Expect = 1.8 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +2 Query: 362 YTETDVTPTDLFHNDSPTEYLDIPADDNIIIENEDSLEI-NETNSEDYCNIEYLSDEDYS 538 +TET+VT D HN Y DI D+ I+ D E +E N ED D D Sbjct: 116 HTETEVTNVDAAHN----FYEDINVDEEDDIDEGDENEYEDEDNEED-------EDMDVH 164 Query: 539 DLQSQLDSKELSL 577 D + +S+E++L Sbjct: 165 DDDTDGESREITL 177 >At4g31160.1 68417.m04423 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); KIAA0800 protein, Homo sapiens GI:3882321 EMBL:AB018343 Length = 1846 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = +2 Query: 371 TDVTPTDLFHNDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDEDYSDLQS 550 +D DL D+ D + +I+I+ + E+ E +ED N E D+D ++Q Sbjct: 1770 SDSGDDDLSSEDNEDSVSDFDEEADILIDGDFMEELIEGENEDDGNGEDEDDDDDGEMQD 1829 Query: 551 QLDSKE 568 + S E Sbjct: 1830 FMSSGE 1835 >At3g17170.1 68416.m02190 ribosomal protein S6 family protein (RFC3) annotation temporarily based on supporting cDNA gi|15620809|dbj|AB057424.1|; contains TIGRfam TIGR00166 and Pfam PF01250 profiles ribosomal protein S6. Length = 314 Score = 29.1 bits (62), Expect = 2.3 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +2 Query: 308 IESVKSLDKHYLKKSLTIYTETDVTPTDLFHN-DSPTEYLDIPADDNIIIENEDSLEINE 484 ++S + + +H + K TE D P FH+ + EY D ++ I ED E Sbjct: 197 LDSDERVIRHLVMKRDEAITE-DCPPPPEFHSVRAGDEYYDDDEEEEI---EEDEDEGEG 252 Query: 485 TNSEDYCNIEYLSDED 532 + ED NIEY D+D Sbjct: 253 EDEEDADNIEYEVDDD 268 >At5g43720.1 68418.m05345 expressed protein Length = 329 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 443 NIIIENEDSLEINETNSEDYCNIEYLSDEDYSDLQSQLDSKE 568 NII+ E+ ET SED ++ LSD+D+ D S D + Sbjct: 171 NIIVAAASGKELEETGSEDDGLLD-LSDDDFFDKGSSSDEAD 211 >At5g42540.1 68418.m05178 5'-3' exoribonuclease (XRN2) identical to XRN2 [Arabidopsis thaliana] GI:11875630; contains Pfam domain PF03159: Putative 5'-3' exonuclease domain Length = 1012 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +2 Query: 386 TDLFHNDSPTEYLDIPADDNI---IIENEDSLEINETNSED 499 +D H+ +YL + DDNI +E E+SL+ E ++E+ Sbjct: 456 SDSLHSSPSRKYLRLSLDDNIGVANVETENSLKAEELDNEE 496 >At3g59410.1 68416.m06626 protein kinase family protein low similarity to GCN2 eIF2alpha kinase [Mus musculus] GI:6066585; contains Pfam profiles PF03129: Anticodon binding domain, PF00069: Protein kinase domain Length = 1241 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 461 EDSLEINETNSEDYCNIEYLSDEDYSDLQSQLDSKELSLVHL 586 +D+ E + TNSE + SD D Q+ K+L +VHL Sbjct: 298 DDTAEDDSTNSESESLGSWSSDSLAQDQVPQISKKDLLMVHL 339 >At1g26960.1 68414.m03287 homeobox-leucine zipper protein, putative / HD-ZIP transcription factor, putative similar to homeobox-leucine zipper protein HAT7 (HD-ZIP protein 7) (HD-ZIP protein ATHB-3 (SP:Q00466| [Arabidopsis thaliana]; similar to Helianthus annuus gi|349379, and carrot, gi|1435022. Contains Homeobox domain motif Length = 255 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 488 NSEDYCNIEYLSDEDYSDLQSQLDSKELSL 577 N + +CN++ DE+YSD S++ K+ L Sbjct: 46 NVQGFCNLDMNGDEEYSDDGSKMGEKKRRL 75 >At4g22370.1 68417.m03233 hypothetical protein Length = 205 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +2 Query: 143 YEDIVEVNPECSPDLPQCVCYLCAGLLKKYSRFKSKCLVAQSLFYKILKSGKKVNI 310 Y DI + N E ++ C + L KY + K V ++ I+K GK + I Sbjct: 131 YSDIKDRNIEGISEVIGDECQFFSNFLSKYRLLQGKKQVMAFFYWLIMKLGKDIKI 186 >At5g64840.1 68418.m08157 ABC transporter family protein Length = 692 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 344 KKSLTIYTETDVTPTDLFHNDSPTEYLDIPADD 442 +K+ + + VTP+ L D PT +LDIP+ + Sbjct: 548 EKARLAFCKFMVTPSTLLVLDEPTNHLDIPSKE 580 >At5g23890.1 68418.m02806 expressed protein weak similarity to SP|P12957 Caldesmon (CDM) {Gallus gallus} Length = 946 Score = 27.5 bits (58), Expect = 7.1 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 3/95 (3%) Frame = +2 Query: 311 ESVKSLDKHYLKKSLTIYTETDVTPTDLFHNDSPTEYLDIPADDNIIIENEDS--LEINE 484 ++ +S+ ++ + L + ETD + S ++ L + + I+++ E S + + Sbjct: 199 DATESIPQNTPEADLMVNAETDPETAESEKIISESKSLLDSSTEPILLDAESSNLVGVEN 258 Query: 485 TNSEDYCNIEYLSDEDYSDLQSQLDS-KELSLVHL 586 TNSED ++ + SDL++ ++S KE SL L Sbjct: 259 TNSEDPESLLNTEPTNVSDLENHVNSQKEDSLSSL 293 >At2g42700.1 68415.m05287 expressed protein Length = 788 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 416 EYLDIPADDNIIIENEDSLEINETNSEDYCNIEYL-SDEDYSDLQSQLDSKE 568 E +IP+DD + I+ D + E+ ++ +DE Y D+Q +LD ++ Sbjct: 590 ETKEIPSDDQLDIDALDDDPWGKWGDEEEEEVDNSKADESYDDMQLKLDLRD 641 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 137 TYYEDIVEVNP--ECSPDLPQCVCYLCAGLLKKYSRFKSKC 253 +Y ++ ++N +C+PDL Q CY C L Y+ K C Sbjct: 185 SYLGEVYDLNGLVQCTPDLNQYDCYRC--LKSAYNETKDCC 223 >At4g18240.1 68417.m02709 starch synthase-related protein contains similarity to starch synthase GI:4582783 from [Vigna unguiculata] Length = 1040 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = +2 Query: 422 LDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDEDYSDLQSQLDSKELSLVHLQE 592 +DI DD ++N E+ + S + E +SD + +L + + S E +++ L E Sbjct: 148 IDIGHDDGKNLDNITVPEVAKALSLNKSEGEQISDGQFGELMTMIRSAEKNILRLDE 204 >At3g47270.1 68416.m05135 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At2g14140, At3g30450, At4g03990, At5g34895, At2g02200 Length = 671 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 395 FHNDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDE 529 + D TE +IP + +E E+ + E E+ +EY DE Sbjct: 323 YRGDERTEKQEIPKQGDEEMEGEEEKQKEEGKEEEEEKVEYRGDE 367 >At3g30450.1 68416.m03852 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At2g14140, At4g03990, At5g34895, At3g47270, At2g02200 Length = 800 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 395 FHNDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDE 529 + D TE +IP + +E E+ + E E+ +EY DE Sbjct: 404 YRGDEGTEKQEIPKQGDEEMEGEEEKQEEEGKEEEEEKVEYRGDE 448 >At3g03200.1 68416.m00316 no apical meristem (NAM) family protein similar to NAC2 (GI:6456751) {Arabidopsis thaliana} Length = 479 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Frame = +2 Query: 278 KILKSGKKVNIESVKSLDKHYLKKSLTIYTETDVTPTDL-FHNDSPTEYLDIPADDNIII 454 +++ S + +N + + +K K I + D T D FH ++ + +DI + I Sbjct: 305 QLITSNRHMNQNYIYAFEKTGYIKEQKIRSSLDNTDEDPGFHGNNTNDNIDIDDFLSFDI 364 Query: 455 ENEDSLEINETNSEDYCNIEYLSDEDYSDLQSQ 553 NED++ E N ED E L + ++ + Sbjct: 365 YNEDNVNQIEDN-EDVNTNETLDSSGFEVVEEE 396 >At2g04970.1 68415.m00518 hypothetical protein similar to At2g15200, At1g32830, At2g14140, At3g30450, At4g03990, At5g34895, At3g47270, At2g02200 Length = 808 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 395 FHNDSPTEYLDIPADDNIIIENEDSLEINETNSEDYCNIEYLSDE 529 + D TE +IP + +E E+ + E E+ +EY DE Sbjct: 491 YRGDEGTEKQEIPKQGDEEMEGEEEKQEEEGKEEEEEKVEYRGDE 535 >At1g69770.1 68414.m08028 chromomethylase 3 (CMT3) nearly identical to chromomethylase CMT3 [Arabidopsis thaliana] GI:14583092, GI:14647157 Length = 839 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 7/66 (10%) Frame = +2 Query: 392 LFHNDSPTEYLDIPADDNIIIENE-DSLEI-----NETNSEDYCNIEYLSD-EDYSDLQS 550 L HN T ++ A+D + + E + L I N NSE+Y N+ L++ ED D+ Sbjct: 312 LQHNHPETNVRNMTAEDFLFLLKEWEKLCIHFSLRNSPNSEEYANLHGLNNVEDNEDVSE 371 Query: 551 QLDSKE 568 + ++++ Sbjct: 372 ESENED 377 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,012,947 Number of Sequences: 28952 Number of extensions: 208476 Number of successful extensions: 653 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -