BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10h24 (631 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1299 + 32450998-32451134,32451575-32452304,32452856-324530... 27 9.3 >04_04_1299 + 32450998-32451134,32451575-32452304,32452856-32453053, 32453398-32454065,32454555-32454978,32455917-32456009, 32456101-32456295,32456378-32456470,32456718-32456930, 32457015-32457104,32457239-32457400 Length = 1000 Score = 27.5 bits (58), Expect = 9.3 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 4/80 (5%) Frame = +3 Query: 348 VYSVIMKLKKEVDINHG-DSVVWKNIEMASG--PNSPVQTEQDIEDI-FGDSLKTWDHFT 515 ++S++ LK ++ G SV + +G P V T D+ED GDS + Sbjct: 614 LFSIVEDLKTDLFTASGWPSVSGDALRSLAGKLPTDLVYTTDDVEDDDSGDSEISEHDLN 673 Query: 516 DDAKKNTFHDAISETQKGKQ 575 D A T ++A +KGK+ Sbjct: 674 DTASYGTAYEAFGGGKKGKE 693 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,139,015 Number of Sequences: 37544 Number of extensions: 243816 Number of successful extensions: 549 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 549 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -