BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10h18 (469 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 1.00 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 24 2.3 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 24 2.3 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 7.0 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 22 9.3 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.4 bits (53), Expect = 1.00 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 302 FTGEISPAMIKDVGVNWVILGHSERRTI 385 F G + A + ++ V W++L H RT+ Sbjct: 96 FAGIVITATVGNLIVVWIVLSHKRMRTV 123 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 24.2 bits (50), Expect = 2.3 Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 98 FVVGGNWKMNGDKNQINEIVNNLKKGP-LDPNVEVIVGVPAIYLSYVKTIIP 250 F+ G W++ G + NEI N P +D +++ +Y + I+P Sbjct: 174 FITNGEWELLGVPGKRNEIYYNCCPEPYIDITFAILIRRKTLYY-FFNLIVP 224 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 24.2 bits (50), Expect = 2.3 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +2 Query: 98 FVVGGNWKMNGDKNQINEIVNNLKKGP-LDPNVEVIVGVPAIYLSYVKTIIP 250 FV G W + G + NEI N P +D +I+ +Y + I+P Sbjct: 206 FVTNGEWDLLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYY-FFNLIVP 256 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 22.6 bits (46), Expect = 7.0 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -3 Query: 128 HSSSSYLQQQICDPFLLSYLSFQLFNKYRVS 36 +S +S + C P L S +++++ N Y +S Sbjct: 163 NSRTSIIDLTFCSPALASSMNWRVSNAYTLS 193 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 22.2 bits (45), Expect = 9.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 101 VVGGNWKMNGDKNQINEIVNNLKK 172 V+ G W +G ++ INEI +K Sbjct: 171 VLFGRWVADGKRDMINEISLKTRK 194 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 456,448 Number of Sequences: 2352 Number of extensions: 8588 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -