BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10h13 (604 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_932| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-11) 29 2.2 SB_39473| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) 28 6.7 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35) 27 8.8 SB_30259| Best HMM Match : Apolipoprotein (HMM E-Value=0.0059) 27 8.8 >SB_932| Best HMM Match : Peptidase_A17 (HMM E-Value=2.4e-11) Length = 665 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 468 ILRIFSVTP*RRGIISLTMQRKIPSTTLSVKLKGKTMRTSPL 593 I R ++ +R +++L Q P SVK +GK +SPL Sbjct: 336 IRRRMNIETAKREVVALVQQEVYPGELKSVKAEGKVQESSPL 377 >SB_39473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 73 LQHLHDETTQSG*HHSTPSGLCRTADPSAETKTTQANLEQEEPP 204 ++ HDET + S+ G+ + DPSA+ + Q ++ E P Sbjct: 5 MEREHDETNEEESDSSSDEGMEQDKDPSADAEIHQLEVQLETNP 48 >SB_14640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +2 Query: 305 TKQVHDKMNVKHHSPVYSVIMKLKKEVDINHGDSVVWKN--IEMASGPNSPVQTEQDIED 478 TK++H M +P I ++ EVD + G+ V+ N +++ P + EQD+ + Sbjct: 167 TKELHKAMRTLGFNPTEEEIQEMVNEVDYD-GNGVLDFNEFVDLMENQKKPDEEEQDLIN 225 Query: 479 IF 484 F Sbjct: 226 AF 227 >SB_57416| Best HMM Match : rve (HMM E-Value=0.0011) Length = 807 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 498 RRGIISLTMQRKIPSTTLSVKLKGKTMRTSPL 593 +R +++L Q P SVK +GK +SPL Sbjct: 485 KREVVALVQQEVYPGELKSVKAEGKVQGSSPL 516 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 90 RNNTVRMTSFNTLWTMSNSRSISRNKNYTSKP*TRGATS 206 + NT+ MTS T+ S++ N TSK T+G S Sbjct: 750 QENTIDMTSHGTIMISKKRELTSQDANKTSKKTTKGLPS 788 >SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35) Length = 1595 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 91 ETTQSG*HHSTPSGLCRTADPSAETKTTQANLEQE 195 ++ +SG + PS LC T E K T+ LE + Sbjct: 12 KSNESGPERNVPSKLCETRSECRERKRTERTLEYD 46 >SB_30259| Best HMM Match : Apolipoprotein (HMM E-Value=0.0059) Length = 422 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = +2 Query: 401 DSVVWKNIEMASGPNSPVQTEQDIEDIFGDSLKTWDHFTDDAKKNTFHDAISETQRENNE 580 + V W E S + P T + ++ + D+ + H DD ++ H + + RE+ + Sbjct: 185 ECVKWTARERQSVEDLPDDTRESVKHLPDDTREHIKHLPDDTRERVKH--LPDDTRESVK 242 Query: 581 DFP 589 D P Sbjct: 243 DLP 245 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,397,731 Number of Sequences: 59808 Number of extensions: 269030 Number of successful extensions: 765 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 764 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -