BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10h08 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.7 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 3.6 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 22 4.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.3 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 8.3 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 92 NATKSSGLTSPLSVSTSPPGKPAT 115 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSKWAS 307 N+TKS+ ++S +SV S P K A+ Sbjct: 136 NATKSSGLTSPLSVSTSPPGKPAT 159 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 Query: 236 NSTKSTMMSSRVSVGCSCPSK 298 N+TKS+ ++S +SV S P K Sbjct: 136 NATKSSGLTSPLSVSTSPPGK 156 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -3 Query: 601 DVLR*CSRILCRQKS*WESSRRHSFSQTRRPFP 503 DV+ R++ + W S R H++ T +P Sbjct: 55 DVMADIERVIMPGVTHWHSPRFHAYFPTANSYP 87 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 8.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 584 QQNSLPAEKLVGIQSPPQFFTNKKAFSLL 498 ++ SLP KL+ ++ F N + SLL Sbjct: 595 RKKSLPVRKLLELERAQHEFKNGDSSSLL 623 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.0 bits (42), Expect = 8.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 602 GCSPLVQQNSLPAEKLVGIQSPPQFFTNKK 513 G P V+ S+ +E + I P FF N+K Sbjct: 104 GKRPGVETLSVGSEFIKNIWVPDTFFVNEK 133 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,594 Number of Sequences: 336 Number of extensions: 2268 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -