BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10h02 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0217 + 15814303-15814905 34 0.086 08_01_0534 - 4635122-4635380,4635716-4635837 32 0.46 11_06_0480 - 24081075-24081723,24083427-24084202 29 4.3 05_05_0303 - 23958989-23960563,23962628-23962864,23963250-239634... 28 5.6 05_06_0278 + 26894802-26895362 28 7.5 04_04_0585 - 26386248-26386271,26386510-26386699,26387363-263874... 28 7.5 02_03_0097 + 15166077-15166349,15166623-15166694,15166715-151671... 27 9.9 >12_02_0217 + 15814303-15814905 Length = 200 Score = 34.3 bits (75), Expect = 0.086 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 5 SGSAAGLCQGTRVQRDRPNMWLGSRGPGATAG 100 + AAG CQ R +R +WLGS G G T G Sbjct: 166 AAGAAGFCQRRRRERRSATVWLGSSGRGKTEG 197 >08_01_0534 - 4635122-4635380,4635716-4635837 Length = 126 Score = 31.9 bits (69), Expect = 0.46 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = +1 Query: 7 GQRSGTVPGYPRAT-RPPQHV----AGVAWARCDGRRRPATSLGLWTGRATDVTR 156 GQR G P + R Q V +GV W C GR +++G WTG A + TR Sbjct: 46 GQRGGGSPAAQLSVAREWQRVEGDGSGVKWKSCGGRTGSRSAVGRWTG-AVEATR 99 >11_06_0480 - 24081075-24081723,24083427-24084202 Length = 474 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 128 QRPSDVAGRRRPSHRAHATPATCWGGRVARGYPGTVP 18 +RP ++ RR S + + PA+C GGRV +VP Sbjct: 62 RRPHLLSLRRPSSSSSSSVPASCGGGRVDGDLTASVP 98 >05_05_0303 - 23958989-23960563,23962628-23962864,23963250-23963449, 23964088-23964250,23964348-23964554,23964667-23964798 Length = 837 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 12 AQRDCARVPACNATAPTCGWGRVGPVRRPAASSDV 116 +Q D +V + + A TC WGR VRR SD+ Sbjct: 480 SQSDEMKVDSEDKPAGTCKWGRAFSVRRRKKLSDI 514 >05_06_0278 + 26894802-26895362 Length = 186 Score = 27.9 bits (59), Expect = 7.5 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +1 Query: 13 RSGTVPGYPRATRPPQHVAGVAWARCDGRRRPATSLGLWTGRATDVTRLDDSRP 174 RSG P P++ RP +AGV GR T G +T DD +P Sbjct: 75 RSGGAPPPPQSNRPVTPLAGVDGGVSGGRAPTNTPPSPQPGGSTKPLSDDDGKP 128 >04_04_0585 - 26386248-26386271,26386510-26386699,26387363-26387463, 26387554-26387685,26387759-26387857,26387956-26388127, 26388217-26388512,26388601-26388726,26388848-26389062, 26389154-26389225,26389299-26389368,26389441-26389517, 26389605-26389923,26390034-26390225,26390321-26390551, 26390585-26390950,26392251-26392313,26392394-26392456, 26392544-26392642,26393497-26393523,26394299-26394358, 26395230-26396147,26396243-26397268 Length = 1645 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = -3 Query: 101 RRPSHRAHATPATCWGGRVARGYPG---TVPLR 12 R P RA + PAT G R +R PG +VP R Sbjct: 224 RSPGRRADSVPATASGERASRQQPGKMVSVPAR 256 >02_03_0097 + 15166077-15166349,15166623-15166694,15166715-15167161, 15167579-15167794,15167873-15168213,15168329-15168947 Length = 655 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 128 QRPSDVAGRRRPSHRAHATPATCWGGRVARGYPGTVP 18 +RP V G P + H T GGRV RG+ T P Sbjct: 233 KRPMKVDGNHFPVNMVHTAGRTADGGRV-RGFQKTKP 268 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,847,781 Number of Sequences: 37544 Number of extensions: 326579 Number of successful extensions: 1087 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -