BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g24 (566 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.4 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.4 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 234 FTEYVL*FLFCGFVWYITHENRSHGFIHDALFLFFFTFIHLYNCML 97 FT ++L L C + +Y H FI + L F I+ + C L Sbjct: 248 FTVHLL-LLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFYCAL 292 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 67 CIFMR*IVKLLFRKCLFH 14 C F+ V LLF C++H Sbjct: 151 CAFIIFTVHLLFLLCIYH 168 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.316 0.132 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,761 Number of Sequences: 336 Number of extensions: 2644 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -