BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g19 (564 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80620.1 68414.m09461 ribosomal protein S15 family protein si... 48 6e-06 At1g15810.1 68414.m01897 ribosomal protein S15 family protein co... 45 4e-05 At5g66950.1 68418.m08440 expressed protein 33 0.17 At1g68790.1 68414.m07863 expressed protein 32 0.23 At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 31 0.53 At3g52300.1 68416.m05748 ATP synthase D chain-related contains w... 31 0.70 At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM dom... 29 2.8 At3g50030.1 68416.m05470 hypothetical protein 28 3.7 At5g26160.1 68418.m03111 expressed protein 28 5.0 At1g05410.1 68414.m00549 expressed protein 28 5.0 At5g62560.1 68418.m07851 armadillo/beta-catenin repeat family pr... 27 6.5 At5g08150.1 68418.m00951 hypothetical protein hypothetical prote... 27 6.5 At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3)... 27 6.5 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 27 6.5 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 27 6.5 At5g10420.1 68418.m01208 ripening-responsive protein, putative s... 27 8.7 At4g30090.1 68417.m04279 expressed protein 27 8.7 At4g11970.1 68417.m01905 YT521-B-like family protein contains Pf... 27 8.7 At4g09150.1 68417.m01515 T-complex protein 11 contains Pfam PF05... 27 8.7 At3g14470.1 68416.m01833 disease resistance protein (NBS-LRR cla... 27 8.7 At3g01085.1 68416.m00012 protein kinase family protein contains ... 27 8.7 At2g35510.1 68415.m04349 WWE domain-containing protein contains ... 27 8.7 At2g03380.1 68415.m00297 pentatricopeptide (PPR) repeat-containi... 27 8.7 At1g67000.1 68414.m07618 protein kinase family protein contains ... 27 8.7 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 27 8.7 At1g32490.1 68414.m04009 RNA helicase, putative similar to ATP-d... 27 8.7 >At1g80620.1 68414.m09461 ribosomal protein S15 family protein similar to ribosomal protein S15 GB:AAD36415 from [Thermotoga maritima] Length = 414 Score = 47.6 bits (108), Expect = 6e-06 Identities = 42/165 (25%), Positives = 75/165 (45%) Frame = +1 Query: 64 LRRFACSAIQSRGLKHQVNIKWVRPEYVPAYKPEKSGDLEGLPPIPENSIADIYALSEEI 243 LR Q + H + +R E+ K +KS + S Y L E Sbjct: 247 LRAMEEEQFQKTSIVHPSFVNNLRSEFHKFTKAQKSDPFQNTNIWGVLSGTPKYML-EPP 305 Query: 244 KDAPESVKKIFSVAHLGQKEFHTLVKKELVNRVKRHQYDENSAENKIARLTAYIRCIQNI 423 KD + V+ F ++ E + ++ K + D SA ++A+LT I+ + ++ Sbjct: 306 KD--QLVETYFHPDNMSSAEKMKIELAKVREEFKMSESDCGSARVQVAQLTTKIKHLSSV 363 Query: 424 MEKNPRNSKMKQTVQEMIDRRKKLLKYLRQYDYKKFEWLLXKLNI 558 + K ++S+ + + M+ RRKKLLKY+R+ D+ + L KL + Sbjct: 364 LHKKDKHSR--KGLIAMVQRRKKLLKYMRRTDWDSYCLSLSKLGL 406 >At1g15810.1 68414.m01897 ribosomal protein S15 family protein contains similarity to ribosomal protein S15 Length = 419 Score = 44.8 bits (101), Expect = 4e-05 Identities = 24/72 (33%), Positives = 45/72 (62%) Frame = +1 Query: 343 KRHQYDENSAENKIARLTAYIRCIQNIMEKNPRNSKMKQTVQEMIDRRKKLLKYLRQYDY 522 K + D SA ++A+LT I+ + + + K ++S+ + + M+ +RKKLLKYLR+ D+ Sbjct: 342 KMSESDCGSARVQVAQLTTKIKHLSSSLHKKDKHSR--KGLLGMVQKRKKLLKYLRRTDW 399 Query: 523 KKFEWLLXKLNI 558 + +L KL++ Sbjct: 400 DSYCLVLSKLSL 411 >At5g66950.1 68418.m08440 expressed protein Length = 870 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +1 Query: 61 MLRRFACSAIQSRGLKHQVNIKWVRPEYVPAYKPEKSGDLEGLPPIPENSIA 216 ++++ S +QS+ K I + PEY P Y + LEGL I +N IA Sbjct: 373 LIKKSVISCLQSQSGKTSSGIVKITPEY-PLYLSDSMDGLEGLTGIQDNGIA 423 >At1g68790.1 68414.m07863 expressed protein Length = 1085 Score = 32.3 bits (70), Expect = 0.23 Identities = 23/121 (19%), Positives = 54/121 (44%), Gaps = 5/121 (4%) Frame = +1 Query: 163 EKSGDLEGLPPIPENSIADIYALSEEIKDAPESVKKIFSVAHLGQKEFHTLVKKELVNRV 342 E +E I EN I E+ + ES+K + L +K+F + K + Sbjct: 273 ENERTIEKKEKILENLQQKISVAKSELTEKEESIKIKLNDISLKEKDFEAMKAKVDIKEK 332 Query: 343 KRHQYDENSAENKIARLTAYIRCIQNIMEKNPRN-----SKMKQTVQEMIDRRKKLLKYL 507 + H+++EN E + + + + +++ R +M++++ E ++ +K ++ L Sbjct: 333 ELHEFEENLIEREQMEIGKLLDDQKAVLDSRRREFEMELEQMRRSLDEELEGKKAEIEQL 392 Query: 508 R 510 + Sbjct: 393 Q 393 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 31.1 bits (67), Expect = 0.53 Identities = 25/102 (24%), Positives = 47/102 (46%) Frame = +1 Query: 202 ENSIADIYALSEEIKDAPESVKKIFSVAHLGQKEFHTLVKKELVNRVKRHQYDENSAENK 381 E +A + A S+ D + +K++ + +KE L K + K EN+ K Sbjct: 781 EKQLASLEAASQPKTDEIDRLKELKKIISKEEKEIENLEKGSKQLKDKLQTNIENAGGEK 840 Query: 382 IARLTAYIRCIQNIMEKNPRNSKMKQTVQEMIDRRKKLLKYL 507 + A + IQ ++KN N+++ + I+ +KL+K L Sbjct: 841 LKGQKAKVEKIQTDIDKN--NTEINR-CNVQIETNQKLIKKL 879 >At3g52300.1 68416.m05748 ATP synthase D chain-related contains weak similarity to ATP synthase D chain, mitochondrial (EC 3.6.3.14) (Swiss-Prot:P31399) [Rattus norvegicus] Length = 168 Score = 30.7 bits (66), Expect = 0.70 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%) Frame = +1 Query: 136 PEYV----PAYKPEKSGDLEGLPPIPENSIADIYALSEEIKDAPESVKKIFSVAHLGQKE 303 P+YV P YKP+ L L + S+ + L +EI D E KK+ ++ E Sbjct: 89 PKYVDKVTPEYKPKFDALLVELKEAEQKSLKESERLEKEIADVQEISKKLSTMTADEYFE 148 Query: 304 FHTLVKKELVNRVKRHQY 357 H +KK+ + ++ + Sbjct: 149 KHPELKKKFDDEIRNDNW 166 >At1g03370.1 68414.m00316 C2 domain-containing protein / GRAM domain-containing protein contains Pfam profiles PF00168: C2 domain; contains PF02893: GRAM domain; similar to Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length(GI:6980525); similar to Synaptotagmin III (SytIII) (Swiss-Prot:P40748) [Rattus norvegicus] Length = 1859 Score = 28.7 bits (61), Expect = 2.8 Identities = 26/96 (27%), Positives = 48/96 (50%), Gaps = 1/96 (1%) Frame = +1 Query: 97 RGLKHQVNIKWVRPEYVPAYKPEKSGDLEGLPPIPENSIADIYALSEEIKDAPESVKKIF 276 R LK Q +K +R E A + +K L + EN+ + + +K+A ++K F Sbjct: 529 RLLKDQPELKALRKEREEAEQYKKEKQL-----LEENTRKRLSEMDFALKNATSQLEKAF 583 Query: 277 SVAHLGQKEFHTLVKKEL-VNRVKRHQYDENSAENK 381 + AH + E +++KKE+ ++K + E+ E K Sbjct: 584 NTAHRLELE-QSILKKEMEAAKIKAVESAESFREAK 618 >At3g50030.1 68416.m05470 hypothetical protein Length = 501 Score = 28.3 bits (60), Expect = 3.7 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +1 Query: 406 RCIQNIME-KNPRNSKMKQTVQEMIDRRKKLLKYLRQYDYKKF 531 R I+N+ E K R K K + ++ R+K++K L++ KKF Sbjct: 329 RSIENLWEIKVERKKKEKLMSETELEERRKMVKSLKKQGKKKF 371 >At5g26160.1 68418.m03111 expressed protein Length = 1058 Score = 27.9 bits (59), Expect = 5.0 Identities = 21/72 (29%), Positives = 33/72 (45%) Frame = +1 Query: 145 VPAYKPEKSGDLEGLPPIPENSIADIYALSEEIKDAPESVKKIFSVAHLGQKEFHTLVKK 324 V ++ E+SG E P E+S +I + E +KD ESV F + + +K Sbjct: 321 VETFQQERSGLEESNDPNTESSRIEIIDVHEILKDEDESV---FEETYFIDQLSVAALKS 377 Query: 325 ELVNRVKRHQYD 360 E N + +H D Sbjct: 378 EPSNLLPKHSVD 389 >At1g05410.1 68414.m00549 expressed protein Length = 471 Score = 27.9 bits (59), Expect = 5.0 Identities = 22/101 (21%), Positives = 49/101 (48%), Gaps = 1/101 (0%) Frame = +1 Query: 175 DLEGLPPIPENSIADIYALSEEIKDAPESVKKIFSVAH-LGQKEFHTLVKKELVNRVKRH 351 D+ + PIP N A+++ L EEI + +++K + + + + H +KE ++ + R Sbjct: 348 DVTPIGPIPFNHEAEMHKLEEEIGEVLRALRKAQEFEYQIAEGKLH--AQKECLSDLYRQ 405 Query: 352 QYDENSAENKIARLTAYIRCIQNIMEKNPRNSKMKQTVQEM 474 E S ++ T + N++++ + K ++EM Sbjct: 406 LEKEKSELSRRVSGTDANSLMTNVLKRLDQIRKEVTKLKEM 446 >At5g62560.1 68418.m07851 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 559 Score = 27.5 bits (58), Expect = 6.5 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +1 Query: 163 EKSGDLEGLPPIPENSIADIYALSEEI----KDAPESVKKIFSVAHLGQKEFH 309 +K + E LPP+ ENS +D A+ E I K++ + SV +GQ +H Sbjct: 138 DKDPEPEILPPVEENSPSDYDAVMEAIRARSKNSMSPTTSLESVT-IGQSSYH 189 >At5g08150.1 68418.m00951 hypothetical protein hypothetical protein F14K14.2 - Arabidopsis thaliana, EMBL:AC011914 Length = 144 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 361 ENSAENKIARLTAYIRCIQNIMEKNPRNSKMKQTVQEMI 477 ++ A + T+Y++ Q I E+N K K+T +EM+ Sbjct: 54 DSDASSGPMEATSYLKLAQEIEEQNSIKKKKKKTNEEMV 92 >At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3) identical to SP|O65607 DNA mismatch repair protein MSH3 (AtMsh3) {Arabidopsis thaliana} Length = 1081 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +1 Query: 118 NIKWVRPEYVPAYKPEKSGDLEGLPPIPENSIADIYALSEEIKDAPESVKKIFSVAHLGQ 297 N +VRPE+V +P + G P+ E + D + ++ I A +I + ++G Sbjct: 763 NKNYVRPEFVDDCEPVEINIQSGRHPVLETILQDNFVPNDTILHAEGEYCQIITGPNMGG 822 Query: 298 K 300 K Sbjct: 823 K 823 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 421 IMEKNPRNSKMKQTVQEMIDRRKKLLKYLRQYDYKKFEWLLXKLNIE 561 I EK R S ++ V+E +DR+++ + + Y+KF L + +E Sbjct: 731 IEEKKLRLSDLQSRVREEVDRQQQEIMSMPDRPYRKFVRLCERQRLE 777 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +1 Query: 421 IMEKNPRNSKMKQTVQEMIDRRKKLLKYLRQYDYKKFEWLLXKLNIE 561 I EK R S ++ V+E +DR+++ + + Y+KF L + +E Sbjct: 731 IEEKKLRLSDLQSRVREEVDRQQQEIMSMPDRPYRKFVRLCERQRLE 777 >At5g10420.1 68418.m01208 ripening-responsive protein, putative similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 456 Score = 27.1 bits (57), Expect = 8.7 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 17 MIN*LLQIYWELLILCCD-VLPVLLF 91 M+ +Q YW +L LCC +LP+ LF Sbjct: 115 MLGVYMQRYWIILFLCCILLLPMYLF 140 >At4g30090.1 68417.m04279 expressed protein Length = 312 Score = 27.1 bits (57), Expect = 8.7 Identities = 22/99 (22%), Positives = 48/99 (48%), Gaps = 4/99 (4%) Frame = +1 Query: 190 PPIPENSIADIYALSEEIKDAPESVKKIFSVAHLGQKEFHTLVKKELVNRVKRHQYDENS 369 P + E+ I D +K A E +K++ + QK+ L ++ R +R + + Sbjct: 83 PYLFESEI-DFSQFENPVKHASEVEEKVYEL----QKQVFGLKREVETQRKRRLEVEAEL 137 Query: 370 AENKIARLTAYIRCIQN-IMEK---NPRNSKMKQTVQEM 474 A+ K+A+L++ + I + K NP S++ ++++ Sbjct: 138 ADKKVAQLSSKLENIDGWFLSKLGLNPTESQVSMKIEQV 176 >At4g11970.1 68417.m01905 YT521-B-like family protein contains Pfam profile PF04146: YT521-B-like family Length = 444 Score = 27.1 bits (57), Expect = 8.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 461 VCFIFEFLGFFSIMFCIQRMY 399 +C IF+ L +FS++F I Y Sbjct: 375 ICSIFQTLSYFSVLFLIHNTY 395 >At4g09150.1 68417.m01515 T-complex protein 11 contains Pfam PF05794: T-complex protein 11 Length = 1097 Score = 27.1 bits (57), Expect = 8.7 Identities = 22/90 (24%), Positives = 35/90 (38%), Gaps = 2/90 (2%) Frame = +1 Query: 250 APESVKKIFSVAHLGQKEFHTLVKKELVNRVKRHQYDENSAENKIARLTAYIRCIQNIM- 426 A +KK + + +K KR E ARLT ++ Sbjct: 172 AQSLMKKAIQETRYKESVRAAIYQKRAAAESKRMGILEAERRRANARLTRVFGAASSVRS 231 Query: 427 EKNPRNSKMKQTVQEMIDRRKKL-LKYLRQ 513 +K KMK ++E + R KKL +Y+R+ Sbjct: 232 QKEAERRKMKDRLEERLQRAKKLKAQYMRR 261 >At3g14470.1 68416.m01833 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 1054 Score = 27.1 bits (57), Expect = 8.7 Identities = 20/73 (27%), Positives = 33/73 (45%) Frame = +1 Query: 262 VKKIFSVAHLGQKEFHTLVKKELVNRVKRHQYDENSAENKIARLTAYIRCIQNIMEKNPR 441 + ++F A L Q F TLV + + KR + +EN E L + + EK Sbjct: 4 IGEMFLAAFL-QALFQTLVSEPFRSFFKRRELNENLLERLSTALLTITAVLIDAEEKQIT 62 Query: 442 NSKMKQTVQEMID 480 N +++ V E+ D Sbjct: 63 NPVVEKWVNELRD 75 >At3g01085.1 68416.m00012 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain; contains non-consensus splice site (GC) at intron 2 Length = 629 Score = 27.1 bits (57), Expect = 8.7 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 2/98 (2%) Frame = +1 Query: 175 DLEGLPPIPENSIADIYALSEEIKDAPESVKKIFSVA--HLGQKEFHTLVKKELVNRVKR 348 D LP P N D E + S+KK ++A LG+ T+ + +NR+ Sbjct: 408 DPSTLPKYPPNKEMDAKYREELQRRRRVSIKKRDNLATKKLGKSRRATVKEPTNLNRLPT 467 Query: 349 HQYDENSAENKIARLTAYIRCIQNIMEKNPRNSKMKQT 462 HQ + AE +I T + P NS + T Sbjct: 468 HQETKKEAETEIVVQTPSETSQATTRSEFPYNSLSQTT 505 >At2g35510.1 68415.m04349 WWE domain-containing protein contains Pfam domain, PF02825: WWE domain Length = 568 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -2 Query: 191 GKPSKSPDFSGLYAGTYSGRTHLMLTWCFKPRL*IAEQAKRRNI 60 GK K P G Y SGR++ L W P + KRRN+ Sbjct: 18 GKKRKHP---GNYTPYDSGRSYAKLQWVLSPNSSTQKLEKRRNL 58 >At2g03380.1 68415.m00297 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 689 Score = 27.1 bits (57), Expect = 8.7 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -3 Query: 436 GFFPLCFVYNECMQLILQSYFQLSFHHTDASSLCLLVLS 320 GF P C + +LIL S H ASS C L+LS Sbjct: 14 GFPPRCVSFTTIKELILTEENDGSSLHYAASSPCFLLLS 52 >At1g67000.1 68414.m07618 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 717 Score = 27.1 bits (57), Expect = 8.7 Identities = 11/41 (26%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 250 APESVKKIF-SVAHLGQKEFHTLVKKELVNRVKRHQYDENS 369 APE + +++ SV+H + ++ E++ K+ ++D+NS Sbjct: 550 APEMISRLYGSVSHKSDVYSYGMLVLEMIGARKKERFDQNS 590 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +1 Query: 196 IPENSIADIY--ALSEEIKDAPESVKKIFSVAHLGQKEFHTLVKKELVNRVK 345 + + I D Y L++ + E+ KI+SV+H F LV ++L +++K Sbjct: 63 LARDEIIDYYIKTLAQVVGSEEEARMKIYSVSHKCYFAFGALVSEDLSHKIK 114 >At1g32490.1 68414.m04009 RNA helicase, putative similar to ATP-dependent RNA helicase #3 [Homo sapiens] GI:3107913; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1044 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 235 EEIKDAPESVKKIFSVAHLGQKEFHTL-VKKELVNRVKRHQYDENSAE 375 +E++D E + +F L + E KKEL + VK+ DE++ E Sbjct: 239 DELRDEIEDEQYLFGGEKLTETELREFRYKKELYDLVKKRTQDEDNVE 286 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,355,416 Number of Sequences: 28952 Number of extensions: 231116 Number of successful extensions: 725 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -