BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g17 (606 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 46 2e-05 SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3148| Best HMM Match : Keratin_B2 (HMM E-Value=0.26) 28 5.1 SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) 28 6.7 SB_33995| Best HMM Match : Cadherin (HMM E-Value=3e-39) 27 8.9 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 46.0 bits (104), Expect = 2e-05 Identities = 20/33 (60%), Positives = 23/33 (69%) Frame = +1 Query: 484 PFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPK 582 PF N PLRRIPQ YVI TST I + + KLP+ Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPE 34 >SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 599 NHH*SVFGSLKLPSEILVEVPIT 531 NHH S FG LP+ + EVPI+ Sbjct: 416 NHHSSSFGPSNLPASLFEEVPIS 438 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +3 Query: 267 NQNSTPQ---T*EVLLPHSGENPCLIWWPSIQQACTQDPTQP 383 NQ++ PQ T VL+PH G PC+ +P+ TQP Sbjct: 94 NQSTLPQGNATQWVLIPHKGSMPCIGTFPNAINTWIIPGTQP 135 >SB_3148| Best HMM Match : Keratin_B2 (HMM E-Value=0.26) Length = 147 Score = 28.3 bits (60), Expect = 5.1 Identities = 22/81 (27%), Positives = 32/81 (39%), Gaps = 4/81 (4%) Frame = +3 Query: 321 NPCLIWWPSIQQACTQDPTQPEDRNCLHSPRW*TCRQEGCT----CWNSAQRSAFSYWTF 488 NPC+ P+ + C Q QP C++S C Q T C + + T Sbjct: 14 NPCVQTAPTSTRVCKQHQHQPV---CVNSTNINPCVQTAPTSTRVCKQHQHQPVCANSTN 70 Query: 489 CIQFVPATPYSSALCDRHLHQ 551 V P S+ +C +H HQ Sbjct: 71 INPCVQTAPTSTRVCKQHQHQ 91 >SB_29467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = +3 Query: 375 TQPEDRNCLHSPRW*TCRQEGCTCWN-SAQRSAFSYWTFCIQFVPATPYS 521 TQ R HSPR CR CT +N + S+ T C + P +S Sbjct: 84 TQEAYRKNSHSPRKRQCRNRLCTSYNWIRNKETSSFVTLCHREKPVGHFS 133 >SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) Length = 356 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 269 PEQYPSNVGSPSTPLRRKSVPHLVAVHSASMYAGSD 376 P Y ++ GSP+ +RK+ PH HS+ A D Sbjct: 112 PMAYLTSTGSPNPQRKRKNDPHRTIDHSSVHRASRD 147 >SB_33995| Best HMM Match : Cadherin (HMM E-Value=3e-39) Length = 632 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 Query: 482 DLLHSIRARYAVFLSAM*SAPPPEFHSATSNCQKHFND 595 +L H R YA ++A S PP FH T+N H D Sbjct: 533 ELRHFERDFYAFVVTATDSTPP--FHKVTANVNVHVTD 568 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,404,453 Number of Sequences: 59808 Number of extensions: 417537 Number of successful extensions: 1092 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1082 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -