BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g15 (438 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0268 - 42411907-42411986,42412476-42412508,42413276-424133... 151 3e-37 03_05_0042 + 20180151-20180468,20181595-20181665,20182929-201830... 31 0.53 07_03_0471 + 18501496-18502104,18503009-18503260,18503367-185035... 29 2.2 01_06_1364 + 36684937-36685281 28 2.9 02_01_0057 + 420812-421556,422473-422597,422622-422912,423357-42... 28 3.8 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 27 5.0 10_08_0796 + 20643667-20643912 27 6.6 08_01_1084 - 11120719-11120950,11121035-11121133,11122446-111228... 27 6.6 10_08_0935 + 21670372-21671396,21672057-21672987 27 8.7 10_01_0106 + 1317848-1318202,1318208-1318872,1318969-1319850,131... 27 8.7 08_02_0841 - 21749599-21749978,21750409-21753367 27 8.7 06_03_0559 + 22148773-22149210,22149478-22149684,22150065-221504... 27 8.7 >01_07_0268 - 42411907-42411986,42412476-42412508,42413276-42413373, 42413499-42413596 Length = 102 Score = 151 bits (365), Expect = 3e-37 Identities = 71/81 (87%), Positives = 76/81 (93%) Frame = +1 Query: 70 KVTFKITLTSDPKLPFKVLSVPEATPFTAVLKFAAEEFRVDPATSAIITDDGIGINPQQT 249 KV+FKI LTSDPKLPFKV SVPEA PFTAVLKFAAEEF+V P TSAIIT+DG+GINPQQ+ Sbjct: 16 KVSFKIILTSDPKLPFKVFSVPEAAPFTAVLKFAAEEFKVPPQTSAIITNDGVGINPQQS 75 Query: 250 AGNVFLKHGSELRLIPRDRVG 312 AGNVFLKHGSELRLIPRDRVG Sbjct: 76 AGNVFLKHGSELRLIPRDRVG 96 >03_05_0042 + 20180151-20180468,20181595-20181665,20182929-20183087, 20183598-20183664,20183913-20184008,20184687-20184733, 20185113-20185193,20185704-20185806,20185967-20186028, 20187188-20187302,20193191-20195087,20195206-20195492 Length = 1100 Score = 30.7 bits (66), Expect = 0.53 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 130 VPEATPFTAVLKFAAEEFRVDPATSAIITDDGIGINPQQTAG 255 VP P A+ AA VDP++ ++ D IG+ + AG Sbjct: 230 VPRKKPDPAIYLLAATTLGVDPSSCVVVEDSTIGLAAAKAAG 271 >07_03_0471 + 18501496-18502104,18503009-18503260,18503367-18503537, 18503693-18503743,18503868-18503960,18504125-18504220, 18504318-18504368,18504452-18504570,18504909-18505017, 18505391-18505513,18505590-18505661,18505963-18506034, 18506125-18506191,18506260-18506402,18506494-18506565, 18506632-18506760,18507317-18507472,18507579-18507692, 18507791-18507889,18507974-18508051,18508402-18508536, 18509081-18509155,18509247-18509361,18509458-18509828, 18509903-18509965,18510049-18510120,18510285-18510413, 18510512-18510628,18510902-18511018 Length = 1289 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 226 IGINPQQTAGNVFLKHGSELRLIPRDRV 309 IG+N ++ A VF K +ELRL+P D + Sbjct: 378 IGLNKKRIAYFVFPKEDNELRLVPGDEL 405 >01_06_1364 + 36684937-36685281 Length = 114 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 187 VDPATSAIITDDGIGINPQQTAGNVFLKHGSELRL 291 +DP T I DDG + +QT V L+ GS + L Sbjct: 67 LDPKTVKFIDDDGRFVRSEQTPEEVGLQDGSTISL 101 >02_01_0057 + 420812-421556,422473-422597,422622-422912,423357-423555, 423737-423800,423894-423957,424055-424135,424334-424420, 424492-424500 Length = 554 Score = 27.9 bits (59), Expect = 3.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 189 HPEFFSCKLQHCSEWSRFRHAKYFKRQF 106 + + SC+L H +EW + H F RQ+ Sbjct: 151 YASWISCELPHRTEWPQVLHGNNFLRQW 178 >02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198, 3366324-3366449,3367056-3367262,3367399-3367492, 3367575-3367621,3367705-3368157,3368261-3368560, 3368656-3369114,3369189-3369410,3369659-3369890, 3370051-3370422,3371210-3371322,3371682-3371903, 3371977-3372180,3372308-3372572,3373123-3373311, 3373441-3373768,3373843-3374248,3374339-3374648, 3375677-3375837,3376825-3376998,3377265-3377609, 3377713-3377754,3378585-3378734,3378847-3379002, 3379088-3379540,3379651-3379966,3380402-3380839, 3381475-3381697,3383538-3383852,3384033-3384095, 3384699-3384903,3385362-3385425,3386014-3386204 Length = 3048 Score = 27.5 bits (58), Expect = 5.0 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 196 ATSAIITDDGIGINPQQTAGNVFLKHGSELRLIPRDRVGFSLI*VHKYVK 345 AT+ + DD +N + +G V G L + +DRV + KY+K Sbjct: 1939 ATNMLARDDSTEVNSNKDSGYVLKDSGYVLNFVQKDRVLAAAADEVKYMK 1988 >10_08_0796 + 20643667-20643912 Length = 81 Score = 27.1 bits (57), Expect = 6.6 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 64 MSKVTFKITLTSDPKLPFKVLSVPEATPFTAVLKFAAEEFRVDPATSAIITDDGIGINPQ 243 MS +T K+ + ++ + EAT A +K E P + G + Sbjct: 1 MSMITVKVKTLTGKEVEVSI----EATETVARIKEQVEAAEGIPPPQQTLIYGGRQLADD 56 Query: 244 QTAGNVFLKHGSELRLI 294 TA L+HGSEL L+ Sbjct: 57 MTAEMCDLRHGSELHLV 73 >08_01_1084 - 11120719-11120950,11121035-11121133,11122446-11122849, 11123559-11124197 Length = 457 Score = 27.1 bits (57), Expect = 6.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 61 KMSKVTFKITLTSDPKLPFKVLSVPEATPFTAVLKFAAEEFRVDPATS 204 K S+++ I +S K P K P ATP VL+ + + P+TS Sbjct: 33 KASELSAAIQSSSSSKRPKKQPPPPRATPIPVVLRRSLRTRGLPPSTS 80 >10_08_0935 + 21670372-21671396,21672057-21672987 Length = 651 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 224 PSSVIIALVAGSTLNSSAANFNTAVNGVASGTLSTLNGSFG 102 PS + +L A ++++SSAA+ + + +G S G FG Sbjct: 161 PSCTVTSLSAKTSVSSSAASDGSGWSNSTAGAGSAAGGGFG 201 >10_01_0106 + 1317848-1318202,1318208-1318872,1318969-1319850, 1319856-1320200,1320286-1320294 Length = 751 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 110 SFGSDVSVILKVTFDILNYT 51 + G+ VSV+LK FD LN+T Sbjct: 520 NLGASVSVVLKDVFDKLNFT 539 >08_02_0841 - 21749599-21749978,21750409-21753367 Length = 1112 Score = 26.6 bits (56), Expect = 8.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 246 LLRIYADTVISDNSTGGRVHPEFFSCKL 163 LLR + ++S+NS G + PE +C+L Sbjct: 303 LLRNLSQLLLSENSLSGPIPPEIGNCQL 330 >06_03_0559 + 22148773-22149210,22149478-22149684,22150065-22150471, 22150655-22151472,22151564-22151674,22151846-22152015 Length = 716 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 249 CLLRIYADTVISDNSTGGRVHPEFFSCKLQHCSEWSRF 136 CLLR+ D ++ + T VHP L++ + WS F Sbjct: 513 CLLRLAHDIIVPKDPTFSEVHP-----NLENLAFWSHF 545 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,247,133 Number of Sequences: 37544 Number of extensions: 194319 Number of successful extensions: 573 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 823860276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -