BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g15 (438 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 2.1 Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 23 6.3 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 23 6.3 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 6.3 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 23 6.3 AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-tran... 23 6.3 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 23 6.3 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 23 6.3 AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-tran... 23 6.3 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 23 6.3 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 22 8.3 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.2 bits (50), Expect = 2.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 197 AGSTLNSSAANFNTAVNGVASGTLSTLNGS 108 + ++L SSAANF + G + LS+++ S Sbjct: 18 SSASLRSSAANFAAWLRGNSGSPLSSISSS 47 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHC 51 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKINPQHC 51 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.6 bits (46), Expect = 6.3 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 121 VLSVPEATPFTAVLKFAAEEFRVD 192 V P TAVL+F+A RVD Sbjct: 252 VAESPRRVDKTAVLRFSAHGLRVD 275 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHC 51 >AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-transferase D1-4 protein. Length = 216 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHC 51 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHC 51 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKINPQHC 51 >AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-transferase protein. Length = 216 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHC 51 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 22.6 bits (46), Expect = 6.3 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -1 Query: 258 ITGCLLRIYADTVISDNSTGGRVHPEFFSCKLQHC 154 +T + + + ++D G + PEF QHC Sbjct: 17 MTAAAVGVELNLKLTDLMKGEHMKPEFLKLNPQHC 51 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 22.2 bits (45), Expect = 8.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 174 SCKLQHCSEWSRFRHAKYF 118 SC L+ S+++RF +YF Sbjct: 402 SCVLERLSQYARFPTRQYF 420 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,951 Number of Sequences: 2352 Number of extensions: 8312 Number of successful extensions: 35 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -