BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g14 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.1 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 6.5 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 8.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 436 SKGKRLKDQKLVPPLKKLFVAGLKQDIEEEDLREYFST 549 S K+ K ++ + + L + GL+ + E+E +R FST Sbjct: 88 SGAKQKKKKRSLMGAQGLSIRGLQINHEDETIRPVFST 125 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 315 KPRDQKDLDLLHILKPIWLMKLKIIGLTKLTEELSSQNEQ 434 KP ++ L L+ + ++ ++ TKL + +S+NE+ Sbjct: 41 KPAMVEEKTQLRYLEELNALRTELGASTKLATDTTSENEE 80 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 212 LFIGGLDYRTTDSSLKEFYEQW 277 +FI L+ ++T S K+ ++W Sbjct: 315 MFIADLNNQSTASDFKQLIDRW 336 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +2 Query: 281 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI 403 E + V+V P+T R G +T ++ + + R H + Sbjct: 69 EKLKVLVPLGPETSRHTTLGLLTKAKRFIKSLEERERKHAV 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,341 Number of Sequences: 438 Number of extensions: 2732 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -