BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g11 (665 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 2.1 AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 25 2.1 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 2.1 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 482 LHHAHHQVDPKETVHR 529 +HH H Q P++ +HR Sbjct: 625 IHHIHQQQYPRQVIHR 640 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.0 bits (52), Expect = 2.1 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 132 NIIFHFLIFVIKTNSLTYT*TR-GFR-WA*KENGVC 233 NI+F L + + S+TYT R G W K G C Sbjct: 246 NIVFMLLTYFLPIGSMTYTYARVGLELWGSKSIGEC 281 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,696 Number of Sequences: 2352 Number of extensions: 13760 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -