BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g11 (665 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) fa... 32 0.30 At2g36720.1 68415.m04505 PHD finger transcription factor, putative 30 1.6 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 29 3.7 At2g46550.1 68415.m05807 expressed protein 28 4.9 At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR ... 28 6.4 At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR ... 28 6.4 >At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) family protein predicted proteins, Arabidopsis thaliana ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 32.3 bits (70), Expect = 0.30 Identities = 25/64 (39%), Positives = 27/64 (42%), Gaps = 11/64 (17%) Frame = +1 Query: 244 RNLDWESKAQLPTKRRRC-----------SPFAASPSTSPGLKTSESKPSSFGESVSAPV 390 RNL + KA LP RR P ASP TSP K S PSS +S V Sbjct: 68 RNLSLKRKASLPNYERRLLLSPSVSETSEKPLVASPITSPYWKRCLSLPSSNSAKLSLVV 127 Query: 391 KITP 402 TP Sbjct: 128 STTP 131 >At2g36720.1 68415.m04505 PHD finger transcription factor, putative Length = 1007 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/67 (23%), Positives = 28/67 (41%) Frame = +1 Query: 199 DFVGRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESV 378 D+ ++K+ C K + S + CS S ++ +TS S P+ V Sbjct: 365 DYASKEKRFTCKRCKGPFPFSSLGHRGFLCKSCSEVETSQASLAATRTSTSAPACITSPV 424 Query: 379 SAPVKIT 399 + +KIT Sbjct: 425 KSRLKIT 431 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 253 DWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESVSAPVKITPE 405 D E +AQ K+ + + + P + +KP+ G+ + A VK TPE Sbjct: 618 DEEEEAQPVVKKELKDAISKAHDSEPEAEKPTAKPAGTGKPLIAAVKATPE 668 >At2g46550.1 68415.m05807 expressed protein Length = 397 Score = 28.3 bits (60), Expect = 4.9 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = +1 Query: 214 KKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPS--TSPGLKT-SESKPSSFGESVSA 384 K ++A +R+LD+ LPT ++ + SP S GL+ S S + G S + Sbjct: 188 KDELASLVAQRSLDYVENCDLPTPQKMKRSYYGSPRGFDSDGLRDYSVSGQTIKGTSKGS 247 Query: 385 PVKITPERMAQEIYDEIKRLH--RRGQLR 465 K PE ++ + + L RR Q R Sbjct: 248 SCKNRPEASSESDLSKSELLEALRRSQTR 276 >At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 223 MACATLKRNLDWESKAQLPTKRRRCSPFAASPST-SPGLK 339 + C + +DWESK +RR SP PST SPG K Sbjct: 711 LMCNISEIRIDWESK-----ERRELSPTEILPSTGSPGFK 745 >At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 27.9 bits (59), Expect = 6.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 223 MACATLKRNLDWESKAQLPTKRRRCSPFAASPST-SPGLK 339 + C + +DWESK +RR SP PST SPG K Sbjct: 711 LMCNISEIRIDWESK-----ERRELSPTEILPSTGSPGFK 745 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,584,131 Number of Sequences: 28952 Number of extensions: 296856 Number of successful extensions: 831 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -