BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g05 (643 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 26 0.88 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 26 0.88 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 26 0.88 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.2 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 1.5 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.0 DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. 25 2.7 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 25 2.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.2 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 26.2 bits (55), Expect = 0.88 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 185 YSALYRLTYFLHLSLRRQLPLRTASVRLLWLKYFFMNSHAFLV 57 Y+A Y + Y+ + L T + L Y+FM ++FL+ Sbjct: 204 YTATYPMDYYNNFYTEEYLNYNTEDIGLNAYYYYFMMDYSFLL 246 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 26.2 bits (55), Expect = 0.88 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 185 YSALYRLTYFLHLSLRRQLPLRTASVRLLWLKYFFMNSHAFLV 57 Y+A Y + Y+ + L T + L Y+FM ++FL+ Sbjct: 204 YTATYPMDYYNNFYTEEYLNYNTEDIGLNAYYYYFMMDYSFLL 246 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 26.2 bits (55), Expect = 0.88 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 185 YSALYRLTYFLHLSLRRQLPLRTASVRLLWLKYFFMNSHAFLV 57 Y+A Y + Y+ + L T + L Y+FM ++FL+ Sbjct: 204 YTATYPMDYYNNFYTEEYLNYNTEDIGLNAYYYYFMMDYSFLL 246 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 28 DTIMFEGHDTTAAGSSFVLCLLGIHQ 53 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 28 DTIMFEGHDTTAAGSSFVLCLLGIHQ 53 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 28 DTIMFEGHDTTAAGSSFVLCLLGIHQ 53 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 28 DTIMFEGHDTTAAGSSFVLCLLGIHQ 53 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 31 DTIMFEGHDTTAAGSSFVLCLLGIHQ 56 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 31 DTIMFEGHDTTAAGSSFVLCLLGIHQ 56 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 42 DTIMFEGHDTTAAGSSFVLCLLGIHQ 67 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 42 DTIMFEGHDTTAAGSSFVLCLLGIHQ 67 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 28 DTIMFEGHDTTAAGSSFVLCLLGIHQ 53 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 28 DTIMFEGHDTTAAGSSFVLCLLGIHQ 53 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 42 DTIMFEGHDTTAAGSSFVLCLLGIHQ 67 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 42 DTIMFEGHDTTAAGSSFVLCLLGIHQ 67 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 42 DTIMFEGHDTTAAGSSFVLCLLGIHQ 67 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 42 DTIMFEGHDTTAAGSSFVLCLLGIHQ 67 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 27 DTIMFEGHDTTAAGSSFVLCLLGIHQ 52 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 27 DTIMFEGHDTTAAGSSFVLCLLGIHQ 52 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 40 DTIMFEGHDTTAAGSSFVLCLLGIHQ 65 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 41 DTIMFEGHDTTAAGSSFVLCLLGIHQ 66 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 41 DTIMFEGHDTTAAGSSFVLCLLGIHQ 66 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D + GH + G++ LC+LGI + Sbjct: 39 DTIMFEGHDTTAAGSSFVLCLLGIHQ 64 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 185 YSALYRLTYFLHLSLRRQLPLRTASVRLLWLKYFFMNSHAFLV 57 Y+A Y + Y+ + L T + L Y+FM ++FL+ Sbjct: 204 YTATYPMDYYNNFYTEEYLNYYTEDIGLNAYYYYFMMDYSFLL 246 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 25.0 bits (52), Expect = 2.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 490 DNLFSSGHTLVSPGATLELCILGIFE 413 D GH + G++ LC+LGI + Sbjct: 3 DTFMFEGHDTTAAGSSFVLCLLGIHQ 28 >DQ974165-1|ABJ52805.1| 482|Anopheles gambiae serpin 5 protein. Length = 482 Score = 24.6 bits (51), Expect = 2.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 384 WTLNILHRKISKMPRMHSSN 443 W + +H+ I + PRMH+SN Sbjct: 355 WQMK-MHKAIVQFPRMHASN 373 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 24.6 bits (51), Expect = 2.7 Identities = 18/69 (26%), Positives = 29/69 (42%) Frame = -2 Query: 597 LELNLFVTLLTANTLIVSGNLLFISSTLTSKGSLSETTCSAADTPLSVLELRWNCAFWAF 418 L L++F L A I++ +L + T+ + + TPL V+ AF Sbjct: 260 LALSVFWLPLDAGERIITNGILALMVTIYLVYFAQQLPAISGHTPLIVIFFSNTLLLTAF 319 Query: 417 SKSSCVIYL 391 S CVI + Sbjct: 320 STIICVIVM 328 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 6.2 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 491 SLKLPLEVNVEEINKRLPETIK 556 SLK+ E N+++ N L TIK Sbjct: 1518 SLKIKTEGNIDDANAELRNTIK 1539 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,330 Number of Sequences: 2352 Number of extensions: 13513 Number of successful extensions: 78 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -