BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g02 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0411 + 8217324-8218172 31 0.91 09_04_0442 - 17630039-17630782 28 6.4 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 28 8.5 >03_02_0411 + 8217324-8218172 Length = 282 Score = 31.1 bits (67), Expect = 0.91 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 51 AGGGRALGTYVNRTSARYVGPPFTSQRWW 137 +GGG +G V T+AR++G RWW Sbjct: 210 SGGGEGVGCEVRMTTARWLGVQQQRLRWW 238 >09_04_0442 - 17630039-17630782 Length = 247 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -1 Query: 125 RSKGWSYISRTRPVHVRSKRPPAACDSDYGPGYR 24 R GW R RP +RS+R S G G+R Sbjct: 160 RRSGWRAWRRGRPARIRSRRRLMRLSSSSGAGHR 193 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 158 PNACSLYPPPLRSKGWSYISRTRPVHVRSKRPPAACD 48 PNA +YPPP SY PV PPA D Sbjct: 523 PNAPPMYPPPPYGYA-SYYPSVTPVQPPPPPPPAGAD 558 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,715,621 Number of Sequences: 37544 Number of extensions: 276975 Number of successful extensions: 663 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -