BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10g02 (713 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089499-1|AAL90237.1| 738|Drosophila melanogaster GH09982p pro... 36 0.041 AE014296-1672|AAF50256.3| 2351|Drosophila melanogaster CG3654-PD... 36 0.041 X57495-1|CAA40732.1| 479|Drosophila melanogaster CDC25 protein. 29 4.7 M24909-1|AAA28916.1| 479|Drosophila melanogaster mitotic initia... 29 4.7 AY069704-1|AAL39849.1| 479|Drosophila melanogaster LD47579p pro... 29 4.7 AE014297-4367|AAF56885.1| 479|Drosophila melanogaster CG1395-PA... 29 4.7 >AY089499-1|AAL90237.1| 738|Drosophila melanogaster GH09982p protein. Length = 738 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/67 (28%), Positives = 35/67 (52%) Frame = +2 Query: 86 QDECEICRTTLYFSKVVGITNKRSAVCILHALRLLESVKYGNKDPSNYEMVLNFSDKDLN 265 + EC++CR LY S V T + C+ HAL+ L + GN +++ ++ D+ Sbjct: 665 ESECDLCRANLYISMV--RTEDGNIYCLQHALKNLNN---GNIQAKQCKLIYAYNVDDIQ 719 Query: 266 ELLLNVQ 286 +L+ +Q Sbjct: 720 QLIRQLQ 726 >AE014296-1672|AAF50256.3| 2351|Drosophila melanogaster CG3654-PD protein. Length = 2351 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/67 (28%), Positives = 35/67 (52%) Frame = +2 Query: 86 QDECEICRTTLYFSKVVGITNKRSAVCILHALRLLESVKYGNKDPSNYEMVLNFSDKDLN 265 + EC++CR LY S V T + C+ HAL+ L + GN +++ ++ D+ Sbjct: 2278 ESECDLCRANLYISMV--RTEDGNIYCLQHALKNLNN---GNIQAKQCKLIYAYNVDDIQ 2332 Query: 266 ELLLNVQ 286 +L+ +Q Sbjct: 2333 QLIRQLQ 2339 >X57495-1|CAA40732.1| 479|Drosophila melanogaster CDC25 protein. Length = 479 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 144 RTSVRLCVSYTRSAYSNPSSTGTKTPQTTRWY*TSPIKISTSYCS 278 R SVR C+S T S ++ ++ KTP+T R P +++ CS Sbjct: 173 RPSVRRCLSMTESNTNSTTTPPPKTPETARDCFKRPEPPASANCS 217 >M24909-1|AAA28916.1| 479|Drosophila melanogaster mitotic initiation protein protein. Length = 479 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 144 RTSVRLCVSYTRSAYSNPSSTGTKTPQTTRWY*TSPIKISTSYCS 278 R SVR C+S T S ++ ++ KTP+T R P +++ CS Sbjct: 173 RPSVRRCLSMTESNTNSTTTPPPKTPETARDCFKRPEPPASANCS 217 >AY069704-1|AAL39849.1| 479|Drosophila melanogaster LD47579p protein. Length = 479 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 144 RTSVRLCVSYTRSAYSNPSSTGTKTPQTTRWY*TSPIKISTSYCS 278 R SVR C+S T S ++ ++ KTP+T R P +++ CS Sbjct: 173 RPSVRRCLSMTESNTNSTTTPPPKTPETARDCFKRPEPPASANCS 217 >AE014297-4367|AAF56885.1| 479|Drosophila melanogaster CG1395-PA protein. Length = 479 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 144 RTSVRLCVSYTRSAYSNPSSTGTKTPQTTRWY*TSPIKISTSYCS 278 R SVR C+S T S ++ ++ KTP+T R P +++ CS Sbjct: 173 RPSVRRCLSMTESNTNSTTTPPPKTPETARDCFKRPEPPASANCS 217 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,343,603 Number of Sequences: 53049 Number of extensions: 479030 Number of successful extensions: 1206 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3170136354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -