BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f24 (474 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 26 3.4 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 25 5.9 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 25 7.8 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 25.8 bits (54), Expect = 3.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 334 QVVTNGNVTKKITVYNFQ 281 +VVT NVT+ +TVY+ Q Sbjct: 208 EVVTENNVTRNVTVYSNQ 225 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 290 IYCDFFSNITIGYHLSVFY 346 IY DF SNIT Y ++Y Sbjct: 840 IYSDFTSNITNNYRPRIYY 858 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 24.6 bits (51), Expect = 7.8 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = -3 Query: 361 LFSFLIEH*QVVTNGNVTKKITVYNFQTFPHHCASFRDSKMLS 233 LF L+++ ++++ +V + + + F + HC++F MLS Sbjct: 534 LFCALLKNPDIISS-SVKQSLLLDGFFRWSQHCSNFNKESMLS 575 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,803,945 Number of Sequences: 5004 Number of extensions: 32655 Number of successful extensions: 67 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -