BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f20 (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) 260 8e-70 SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) 56 3e-08 SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) 30 1.6 SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) 30 1.6 SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) 29 2.2 SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 2.2 SB_4689| Best HMM Match : Dicty_CTDC (HMM E-Value=5.8) 29 3.8 SB_1748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_38738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) 27 8.8 >SB_39807| Best HMM Match : Ribosomal_S8e (HMM E-Value=0) Length = 192 Score = 260 bits (636), Expect = 8e-70 Identities = 122/172 (70%), Positives = 139/172 (80%) Frame = +1 Query: 85 PIRKKRKYELGRPAANTRLGPQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRKTRII 264 P+R KRK+ELGRP ANT++G +RIH VR+RGGN K+RA RLDT NFSWGSE TRK RII Sbjct: 4 PLRHKRKFELGRPPANTKIGTKRIHEVRTRGGNRKFRAFRLDTENFSWGSESCTRKARII 63 Query: 265 DVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEAIINK 444 DVVYNASNNELVRTKTLVKN IV VD+TPFRQWYE+HY +P+GRKK + TE E+ I+NK Sbjct: 64 DVVYNASNNELVRTKTLVKNCIVQVDSTPFRQWYEAHYAIPIGRKKTKQPTEEEQEILNK 123 Query: 445 KRSQKTARKYLARQRLAKVEGALEEQFHTGRLLACVASRPGQCGRADGYILE 600 KRS RK AR+ AKV +EEQF TGRL ACV+SRPGQ GR DGYILE Sbjct: 124 KRSNHCTRKLEARKANAKVAPGMEEQFVTGRLYACVSSRPGQSGRCDGYILE 175 >SB_22712| Best HMM Match : Ribosomal_S8e (HMM E-Value=0.068) Length = 147 Score = 55.6 bits (128), Expect = 3e-08 Identities = 24/77 (31%), Positives = 47/77 (61%) Frame = +1 Query: 145 PQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRKTRIIDVVYNASNNELVRTKTLVKN 324 P++I ++ GG+TK +ALR++ G ++ S+ + I+ V+++ +N E + +VK Sbjct: 37 PEKIKERKAYGGHTKIKALRVNKGVYTLKSQGVEVEAPILSVMHSFANKEHIERNVIVKG 96 Query: 325 AIVVVDATPFRQWYESH 375 +IV VD PF W++ + Sbjct: 97 SIVQVDNKPFEDWFQEY 113 >SB_17079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2537 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 61 RATGGKRAPIRKKRKYELGRPAANTRLGP 147 R GG R P+++ +E +P+ N R GP Sbjct: 769 RRGGGSRVPVKRSSSFENRKPSPNRRRGP 797 >SB_26394| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.88) Length = 842 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 519 AIPHRAFAGLRGESPRSVWSRR 584 A PH A +G+R SPR +W R Sbjct: 108 ACPHHAVSGVRVSSPRGIWCSR 129 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 519 AIPHRAFAGLRGESPRSVWSRRWL 590 A PH A +G+R PRS+W R L Sbjct: 139 AYPHHAVSGVRVSPPRSIWCSRVL 162 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 519 AIPHRAFAGLRGESPRSVWSRRWL 590 A PH A +G+R PRS+W R L Sbjct: 201 ACPHHAVSGVRVSPPRSIWCSRVL 224 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 519 AIPHRAFAGLRGESPRSVWSRR 584 A PH A +G+R PRS+W R Sbjct: 232 ACPHHAVSGVRVSPPRSIWCSR 253 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 519 AIPHRAFAGLRGESPRSVWSRRWL 590 A PH A + +R PRS+W R L Sbjct: 170 ACPHHAVSSVRVSPPRSIWCSRVL 193 >SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) Length = 883 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +1 Query: 400 KGAKLTEAEEAIINKKRSQKTARKYLARQRLAKVEGALEEQFHTGR 537 + AKL + EE II K+ + TA + ++ K++ ALE +G+ Sbjct: 701 RAAKLQQEEEEIIRKREANNTALAAIGPRKKRKLDEALEATRPSGQ 746 >SB_8638| Best HMM Match : PP2C (HMM E-Value=6.5e-32) Length = 905 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +1 Query: 445 KRSQKTARKYLARQRLAKVEGALEEQFHTGRLLACVASRPGQCGRADGYILE 600 ++S+K K + +L +EG E H G LL S C R GY ++ Sbjct: 133 EKSEKYTEKKIRSDKLTWIEGNEEGASHIGDLLLKYDSLVSSCSRRIGYDIQ 184 >SB_37792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 244 TRKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFR 357 T++ +I D++ N N VR +TL+ NA +++D F+ Sbjct: 18 TKRKKIADILSNEIRN--VRERTLILNAALIIDICVFK 53 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 4 VFFFDPTKMGISRDHWHKRRATG--GKRAPIRKKRKYELG 117 VF P+K S+ K+ ATG GK AP +KK+K+ G Sbjct: 474 VFSDSPSKNKESKSTKRKKSATGGEGKEAPAKKKQKHNDG 513 >SB_4689| Best HMM Match : Dicty_CTDC (HMM E-Value=5.8) Length = 530 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/47 (23%), Positives = 24/47 (51%) Frame = -3 Query: 374 CDSYHCLNGVASTTTIAFLTRVFVRTNSLLDALYTTSMIRVLRVEHS 234 CD+ HC + T+T+ + +V + + ++ ++ V R +HS Sbjct: 448 CDNDHCSQELCLTSTVDQIQQVLNNCDKIKTQVHVEGLVEVWRKDHS 494 >SB_1748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 683 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 19 PTKMGISRDHWHKRRATGGKRAPIRKKRK-YELGRPAANTRLGPQRIHSV 165 P +S D W K++ K+ I+KKR+ + A LG QR+ + Sbjct: 383 PKMQSLSYDEWLKQKREQDKKQAIKKKREIIDSHLDAVVAELGKQRVERI 432 >SB_38738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 442 KKRSQKTARKYLARQRLAKVEGALEE 519 K+R QK + Y RQR ++ +LEE Sbjct: 15 KRRKQKATKSYAERQRRTRINKSLEE 40 >SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 243 NSQNPYH*CCV*CI*Q*-IGAYKDPCQECNCCSRCNSI 353 +S YH C C+ I Y DP EC CS+C+ + Sbjct: 192 DSLEVYHECFGGCVGTLEIELYTDPYAECVTCSQCDGV 229 >SB_48089| Best HMM Match : DUF638 (HMM E-Value=3.3) Length = 811 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 122 PLQTPGSALSESTPFVHVVEILSTVRCVWTPVTSLGDRNVQL 247 P ++P L +TP VHVV + R V +TS+ +N+++ Sbjct: 632 PRRSPLLQLLSNTPDVHVVVVELFQRHVHAVLTSMAKKNIKI 673 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,578,244 Number of Sequences: 59808 Number of extensions: 406917 Number of successful extensions: 1128 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -