BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f18 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 25 0.56 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.56 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.56 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 0.98 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 23 3.0 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 4.0 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 5.2 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 9.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.1 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 9.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.1 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 25.0 bits (52), Expect = 0.56 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 347 TIVPSEYWQTK*HVRQSKCAYYQMSFRVIVNEL*HDLEWNVKLNQSY 487 T+ P ++ + ++R + + + FR++ N+L E VK NQ+Y Sbjct: 54 TMTPLDFMDFRCYLRPAS-GFQSLQFRLLENKLGVRQENRVKYNQNY 99 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.0 bits (52), Expect = 0.56 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 347 TIVPSEYWQTK*HVRQSKCAYYQMSFRVIVNEL*HDLEWNVKLNQSY 487 T+ P ++ + ++R + + + FR++ N+L E VK NQ+Y Sbjct: 114 TMTPLDFMDFRCYLRPAS-GFQSLQFRLLENKLGVRQENRVKYNQNY 159 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.0 bits (52), Expect = 0.56 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +2 Query: 347 TIVPSEYWQTK*HVRQSKCAYYQMSFRVIVNEL*HDLEWNVKLNQSY 487 T+ P ++ + ++R + + + FR++ N+L E VK NQ+Y Sbjct: 114 TMTPLDFMDFRCYLRPAS-GFQSLQFRLLENKLGVRQENRVKYNQNY 159 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 278 FWLGTITRLDLIISGANIVLPVSSAADL 195 FWL L I+ G N+VL V + ADL Sbjct: 666 FWLFHCHFLFHIVIGMNLVLQVGTHADL 693 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 542 TCHPKCTPRGSQRGNPYL 595 TC P+ +RGNP+L Sbjct: 499 TCRIFLAPKTDERGNPWL 516 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 22.2 bits (45), Expect = 4.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 540 LHVTPNVPREAASGGTLICPLLLQYQPFRRR 632 +H + ++ R T CP+ LQY P R+ Sbjct: 149 VHHSGSITRSIRLTITASCPMNLQYLPMDRQ 179 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 542 TCHPKCTPRGSQRGNPYL 595 TC P+ +RGNP+L Sbjct: 498 TCRIFLAPQFDERGNPWL 515 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 Query: 291 WFEHILAWHNNPSRLNHFRG 232 WF L H+NPS +G Sbjct: 22 WFRRGLRLHDNPSLREGLKG 41 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 9.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 245 IISGANIVLPVSSAADLIACIAIGAFDGVKICLN 144 ++SG +I S + L C+A AF +N Sbjct: 856 VLSGLSIKRTERSDSALFTCVATNAFGSDDTSIN 889 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 604 SNGQIRVPPLAASRGTFG 551 S GQ+ PP + S G+ G Sbjct: 57 SFGQVNSPPSSTSSGSLG 74 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 602 ASPISALSTTSSNFLPPP 655 A+PIS+ TS PPP Sbjct: 19 ATPISSSGMTSPAAAPPP 36 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,666 Number of Sequences: 336 Number of extensions: 4052 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -