BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f18 (668 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 27 0.71 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 27 0.71 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 27 0.71 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 27 0.71 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 27 0.71 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 27 0.71 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 27 0.71 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 27 0.71 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 27 0.71 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 27 0.71 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 27 0.71 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 27 0.71 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 27 0.71 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 27 0.71 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 27 0.71 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 27 0.71 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 26 0.93 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 26 0.93 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 26 0.93 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 26 0.93 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 26 0.93 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 26 0.93 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 26 0.93 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 26 0.93 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 26 0.93 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 26 0.93 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 25 1.6 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 25 1.6 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 25 1.6 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 25 1.6 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 24 3.8 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 5.0 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 24 5.0 L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 23 6.6 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 23 6.6 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 6.6 DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. 23 6.6 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 8.7 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 96 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 137 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCXRGQGKKNIYLANN 152 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 36 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 77 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 36 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 77 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 36 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 77 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 26.6 bits (56), Expect = 0.71 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 36 NNYVQELLVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 77 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCLRGQGKKNIYLANN 152 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELMVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCLRGQGKKNIYLANN 152 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELLVGPSIETLHAANNNISRVSCLRGQGKKNIYLANN 152 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELMVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELMVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELMVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 36 NNYVQELMVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 77 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 26.2 bits (55), Expect = 0.93 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L++ + + + + N N S C RG G+ ++ N+ Sbjct: 36 NNYVQELMVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 77 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 26.2 bits (55), Expect = 0.93 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 393 WRTCYFVCQYSDGTIVGR 340 W+T YFVC Y+ I+ R Sbjct: 205 WQTYYFVCNYAVTNIIDR 222 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L + + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELXVGPSIETLHAANNNISRVSCXRGQGKKNIYLANN 152 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L + + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELXVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L + + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELXVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 120 SRYSSSLIIEANFDAIESTNGNTSY*ICRRGYGQNDVCPGND 245 + Y L + + + + + N N S C RG G+ ++ N+ Sbjct: 111 NNYVQELXVGPSIETLHAANNNISRVSCSRGQGKKNIYLANN 152 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 24.2 bits (50), Expect = 3.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 291 WFEHILAWHNNPSRL 247 WF H L H+NPS L Sbjct: 8 WFRHGLRLHDNPSLL 22 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.8 bits (49), Expect = 5.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 278 FWLGTITRLDLIISGANIVLPVSSAADL 195 FWL L I+ G N++L V + ADL Sbjct: 708 FWLFHCHFLFHIVIGMNLILQVGTHADL 735 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.8 bits (49), Expect = 5.0 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 553 QMYPERQPAGEPLSAHCFSNISPFDDVIQFFTTANT 660 Q+YP+R+P G P + + D FT NT Sbjct: 636 QLYPDRRPMGYPFDRRMPTAVRSLTD----FTRGNT 667 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +2 Query: 347 TIVPSEYWQTK*HVRQSKCAYYQMSFRVIVNEL*HDLEWNVKLNQSY 487 T+ P ++ + ++ + + + FR++ N+L E VK NQ Y Sbjct: 118 TMTPLDFMDFRDYLSPAS-GFQSLQFRLLENKLGVKSEHRVKYNQKY 163 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +2 Query: 347 TIVPSEYWQTK*HVRQSKCAYYQMSFRVIVNEL*HDLEWNVKLNQSY 487 T+ P ++ + ++ + + + FR++ N+L E VK NQ Y Sbjct: 118 TMTPLDFMDFRDYLSPAS-GFQSLQFRLLENKLGVKSEHRVKYNQKY 163 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 532 VVNYMSPQMYPERQPAGEPLS 594 +V+Y++PQ+Y E+ E LS Sbjct: 708 LVDYLTPQVYTEKLSVPEGLS 728 >DQ974169-1|ABJ52809.1| 508|Anopheles gambiae serpin 11 protein. Length = 508 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 149 LNNEARAVSGHWAYDCCDDKMIETQTKMTLI 57 +NN AR + + D+K I+ QTK+ L+ Sbjct: 252 INNWAREKTRQRIQEVVDEKSIDPQTKLFLM 282 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 8.7 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -1 Query: 407 TRTSIGARAISFASILMGQSLAGTILDNGTISRSLGTAIGSNIFWLGTI 261 TR+ +G ++ +GQ TIL N S + I FWL ++ Sbjct: 566 TRSLLGNLHLAKMQWTLGQKNFETILKNPATSSDAYSLIALGNFWLQSL 614 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 766,091 Number of Sequences: 2352 Number of extensions: 17132 Number of successful extensions: 72 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -