BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f18 (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g60150.1 68418.m07540 expressed protein ; expression supporte... 31 0.52 At5g22800.1 68418.m02666 aminoacyl-tRNA synthetase family protei... 29 2.1 At4g12080.1 68417.m01920 DNA-binding family protein contains a A... 29 2.8 At2g29330.1 68415.m03562 tropinone reductase, putative / tropine... 29 2.8 At5g51340.1 68418.m06366 expressed protein 29 3.7 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 28 6.5 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 28 6.5 At1g48690.1 68414.m05449 auxin-responsive GH3 family protein sim... 28 6.5 At4g17720.1 68417.m02646 RNA recognition motif (RRM)-containing ... 27 8.5 >At5g60150.1 68418.m07540 expressed protein ; expression supported by MPSS Length = 1195 Score = 31.5 bits (68), Expect = 0.52 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +2 Query: 482 SYLLSNIPLTSSTEALRS*ITCHPKCTPRGSQRGNPYLPIASPISALSTTSSN 640 ++LL N P +++ +S + C P PR S R P P SPI ++ TS+N Sbjct: 16 NWLLKNTPKKTNSSRGKSYLKCSPLQIPR-SSRIVPTRPPFSPIGRVTGTSNN 67 >At5g22800.1 68418.m02666 aminoacyl-tRNA synthetase family protein contains Pfam profiles: PF01411 tRNA synthetases class II (A), PF02272 DHHA1 domain Length = 978 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 304 REREIVPLSSIVPANDCPIRILANEIARAPIEVRVLPNEFPC 429 R +++P SS+VP + + +A + PI + +P E PC Sbjct: 94 RGHKVLPSSSLVPEDPTVLLTIAGMLQFKPIFLGKVPREVPC 135 >At4g12080.1 68417.m01920 DNA-binding family protein contains a AT hook motif (DNA binding motifs with a preference for A/T rich regions), Pfam:PF02178 Length = 356 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 5/80 (6%) Frame = -1 Query: 422 NSFGSTRTSIGARAISFASI---LMGQSLAGTILDNGTISRSLGTAIGSNIFW--LGTIT 258 N G TR+ G ++S AS ++G LAG ++ + +G+ + Sbjct: 240 NDSGGTRSRTGGMSVSLASPDGRVVGGGLAGLLVAASPVQVVVGSFLAGTDHQDQKPKKN 299 Query: 257 RLDLIISGANIVLPVSSAAD 198 + D ++S +P+SSAAD Sbjct: 300 KHDFMLSSPTAAIPISSAAD 319 >At2g29330.1 68415.m03562 tropinone reductase, putative / tropine dehydrogenase, putative similar to tropinone reductase SP:P50165 from [Datura stramonium] Length = 260 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -1 Query: 239 SGANIVLPVSSAADLIACIAIGAFDGVKICLNNEARAVSGHWAYD 105 SG I+ +SSAA +++ A + K LN AR ++ WA D Sbjct: 136 SGNGIITFISSAAGIVSFDAASIYGLTKGALNQLARNLACEWAKD 180 >At5g51340.1 68418.m06366 expressed protein Length = 726 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 44 KQWEELESSLFASQSSYHHNSRMPNVQIQL 133 K+W+EL+S L ++ S HH + +I+L Sbjct: 640 KKWDELQSRLAEARGSIHHIELVAKARIEL 669 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 27.9 bits (59), Expect = 6.5 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 6/132 (4%) Frame = +1 Query: 82 SIILSSQQSYAQCP-DTALASLLRQILTPSKAPMAIQAIKSAAEDTGRT-MFAPEMIKSR 255 S + SS++S ++ P + SL R S+ ++ I+S + R+ + + SR Sbjct: 526 SPVRSSRRSLSRSPIQLSRRSLSRSPTRLSRRSLSRSPIRSPRKSVSRSPVRSSRKSVSR 585 Query: 256 RVIVPSQNMFEPIAVPREREIVPLSSIVPA----NDCPIRILANEIARAPIEVRVLPNEF 423 + S+ V R+ V S I + + PIR+ I+R+P+ R + Sbjct: 586 SPVRSSRRRISRSPVRSSRKSVSRSPIRLSRRSISRSPIRLSRRSISRSPVRGRRRISRS 645 Query: 424 PCDCQRTLTRPR 459 P +R RPR Sbjct: 646 PVPARRRSVRPR 657 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 535 VNYMSPQMYPERQPAGEPLSAHCFSNISPFDDV----IQFFTTA 654 +N+M YP +Q A H F SP DD+ I+F T A Sbjct: 335 INHMYQVAYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLA 378 >At1g48690.1 68414.m05449 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 190 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 514 FYRSAPVVNYMSPQMYPERQPAGEPLSAHCFSNISPFDDVIQFFTTANT 660 F ++ PVV+Y + Y ER GEP SNI + + FF ++ T Sbjct: 51 FKKNVPVVSYDDVRPYIERVANGEP------SNIFTGETITNFFLSSGT 93 >At4g17720.1 68417.m02646 RNA recognition motif (RRM)-containing protein Length = 313 Score = 27.5 bits (58), Expect = 8.5 Identities = 21/69 (30%), Positives = 35/69 (50%) Frame = +1 Query: 82 SIILSSQQSYAQCPDTALASLLRQILTPSKAPMAIQAIKSAAEDTGRTMFAPEMIKSRRV 261 S+I+S Y P+ ALASL + +K+P A ++ AED +M A I + Sbjct: 70 SVIVSMAPDYQLSPE-ALASL--EPKDSNKSPKAGDSVLRKAEDVVSSMLAKGFILGKDA 126 Query: 262 IVPSQNMFE 288 I ++++ E Sbjct: 127 IAKAKSVDE 135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,643,330 Number of Sequences: 28952 Number of extensions: 351935 Number of successful extensions: 1006 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -