BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f12 (557 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.3 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 23 1.8 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 7.2 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 9.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 412 YYFQNVSSLETRLRKNHVFWCLDWC 338 YY N L+ ++ N +FW D C Sbjct: 2252 YYLCNQGQLQLQVCPNGLFWNKDHC 2276 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +1 Query: 307 PSRSDDIGTQYTNPNTKRHGF 369 P DD NP K+H F Sbjct: 218 PEEDDDSNIPQNNPKNKQHNF 238 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 298 ITCPSRSDDIGTQYTNPNTKRHGFFANE 381 I C SR Q + ++HG+FA+E Sbjct: 90 IDCTSRPKLQEPQPSQHCPRKHGYFAHE 117 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +3 Query: 273 SIQNGCSKDHLPESERRYRNSIHQSKHQKTWF 368 +++NGC K + E ++ H H+ W+ Sbjct: 65 TMKNGCVKCEQKQKEDVHKVFQHLMIHRPNWW 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,106 Number of Sequences: 336 Number of extensions: 2351 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -