BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f12 (557 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0331 - 22087692-22087946,22088060-22088179,22088338-220884... 29 2.5 >02_04_0331 - 22087692-22087946,22088060-22088179,22088338-22088439, 22088523-22088582,22088657-22088709,22088790-22088875, 22089060-22089104,22089484-22089565,22089670-22089784 Length = 305 Score = 29.1 bits (62), Expect = 2.5 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 4/107 (3%) Frame = -3 Query: 414 STTFKMFRVLRLVCEKTMSFG----VWIGVLSSDIVAPTRAGDLLSNHFV*N*LNSS*AP 247 +T F+ ++L++V S G ++ SD P D ++ H + S P Sbjct: 140 TTIFEYLQLLKMVATSISSAGPLGMFYLAAAVSDFYVPW---DSMAKHKI----QSGGGP 192 Query: 246 KEMLTL*APKQLTVPRVGLSTMNVCKSFKTRVRCDSVFVKKESNLNE 106 +M PK L+V R + + C SFK D + K + LN+ Sbjct: 193 LDMRLSQVPKMLSVLRNQWAPLAFCISFKLETDSDILIQKADMALNK 239 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,709,803 Number of Sequences: 37544 Number of extensions: 231266 Number of successful extensions: 605 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -