BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f12 (557 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC021217-1|AAH21217.2| 473|Homo sapiens NADH dehydrogenase (ubi... 29 8.4 AK056041-1|BAB71080.1| 456|Homo sapiens protein ( Homo sapiens ... 29 8.4 >BC021217-1|AAH21217.2| 473|Homo sapiens NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa protein. Length = 473 Score = 29.5 bits (63), Expect = 8.4 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +2 Query: 380 SLKTRNILKVVDLDRLKPEKNQQAN--GLTGVIHQGNNGVMPQGTVPTASFSEEYLK 544 S K + +L+ +D PEK Q G +G P+ T+P + EE+LK Sbjct: 204 SAKEKTLLQKPHVDITDPEKPHQPKKKGSPAKPSEGRENARPKTTMPRSQVDEEFLK 260 >AK056041-1|BAB71080.1| 456|Homo sapiens protein ( Homo sapiens cDNA FLJ31479 fis, clone NT2NE2001634, moderately similar to NADH-UBIQUINONE OXIDOREDUCTASE 9 KD SUBUNIT PRECURSOR ). Length = 456 Score = 29.5 bits (63), Expect = 8.4 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +2 Query: 380 SLKTRNILKVVDLDRLKPEKNQQAN--GLTGVIHQGNNGVMPQGTVPTASFSEEYLK 544 S K + +L+ +D PEK Q G +G P+ T+P + EE+LK Sbjct: 187 SAKEKTLLQKPHVDITDPEKPHQPKKKGSPAKPSEGRENARPKTTMPRSQVDEEFLK 243 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,883,205 Number of Sequences: 237096 Number of extensions: 1342289 Number of successful extensions: 3622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3622 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5590411794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -