SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10f11
         (437 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       22   2.6  
EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.          21   7.9  
EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      21   7.9  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 22.2 bits (45), Expect = 2.6
 Identities = 11/42 (26%), Positives = 18/42 (42%)
 Frame = +3

Query: 309 EIPKGPKVTHKVSFDMKIGDDNIGTIVIGLFGKTVPXTTENF 434
           E+P   K   +   ++ I  D    I + + G  VP   E+F
Sbjct: 157 ELPNDEKSLFENGVEIGINFDKYDNIQVNVSGDNVPQPIESF 198


>EF625898-1|ABR45905.1|  686|Apis mellifera hexamerin protein.
          Length = 686

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -1

Query: 242 NEFSSFPCYFYK 207
           N FSS P Y YK
Sbjct: 313 NRFSSLPYYKYK 324


>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 20.6 bits (41), Expect = 7.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = -1

Query: 242 NEFSSFPCYFYK 207
           N FSS P Y YK
Sbjct: 313 NRFSSLPYYKYK 324


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,616
Number of Sequences: 438
Number of extensions: 1944
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11327868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -