BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f11 (437 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 2.6 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 7.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 7.9 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 2.6 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +3 Query: 309 EIPKGPKVTHKVSFDMKIGDDNIGTIVIGLFGKTVPXTTENF 434 E+P K + ++ I D I + + G VP E+F Sbjct: 157 ELPNDEKSLFENGVEIGINFDKYDNIQVNVSGDNVPQPIESF 198 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 242 NEFSSFPCYFYK 207 N FSS P Y YK Sbjct: 313 NRFSSLPYYKYK 324 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 242 NEFSSFPCYFYK 207 N FSS P Y YK Sbjct: 313 NRFSSLPYYKYK 324 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,616 Number of Sequences: 438 Number of extensions: 1944 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -