BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f10 (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 119 5e-30 SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) 29 3.1 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 119 bits (286), Expect(2) = 5e-30 Identities = 60/145 (41%), Positives = 88/145 (60%) Frame = +2 Query: 161 DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 340 +VRQ AAVLLRR+F+A Q +++E LL + + +R+K+CD VSEL Sbjct: 27 EVRQMAAVLLRRIFTATVDFLKKIDENTQN-LMKESLLKGIHEEQDSNVRKKICDAVSEL 85 Query: 341 ARNHIDDDGNNQWPEFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGM 520 +++ +DDDG N W E L+F+F C ++ +KE+ + +F S PGVFGN+Q L+VIK M Sbjct: 86 SKSFLDDDGYNHWQELLKFLFECCNSPRAELKESALNIFCSFPGVFGNQQDHYLNVIKQM 145 Query: 521 LISALQPNESMALRTQAVKAVGAFI 595 L + S A+R A +A AFI Sbjct: 146 LWQCINDQTSQAVRFVAARASCAFI 170 Score = 29.9 bits (64), Expect(2) = 5e-30 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 2 MAGDQAQFYQLLNTLLSTDNDIRSQAE 82 MA QF L+ L+S DND R+QAE Sbjct: 1 MADQVQQFEALIGQLMSPDNDTRNQAE 27 >SB_34262| Best HMM Match : efhand (HMM E-Value=6.3e-26) Length = 354 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 314 KVCDVVSELARNHIDDDGNN--QWPEFLQFMFTCASAQDPN 430 ++ D+++++A +D DGN +PEFLQ M DP+ Sbjct: 249 ELMDMMNQIAFLFVDSDGNGAIDFPEFLQLMTKNLQDADPD 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,449,156 Number of Sequences: 59808 Number of extensions: 387520 Number of successful extensions: 973 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -