BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f09 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 31 0.70 SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) 29 2.1 SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) 29 3.7 SB_39792| Best HMM Match : Usp (HMM E-Value=1.2e-14) 29 3.7 SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) 28 4.9 SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) 28 6.5 SB_11395| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-06) 27 8.6 SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 44.8 bits (101), Expect = 5e-05 Identities = 15/27 (55%), Positives = 22/27 (81%) Frame = +2 Query: 287 MIPHKTERGKNALRRLRTYDGCPPPFD 367 MIPHKT++G A+ R++ +DG PPP+D Sbjct: 1 MIPHKTKKGTEAMNRMKVFDGVPPPYD 27 >SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 35.5 bits (78), Expect = 0.033 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 12/117 (10%) Frame = +2 Query: 50 VIDGRGHLLGRLAAVIAKVLL------------EGNKVVVVRCEQINISGNFFRNKLKLM 193 +IDGR + GRLA I ++L G+ VVV+ + I +SG + NKL Sbjct: 20 LIDGRDQICGRLAGYIGQILQGKTKPIYHHAEDVGDYVVVINTKHIVLSGTKWDNKLYRH 79 Query: 194 SFLRKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTERGKNALRRLRTYDGCPPPF 364 H + ++ILW+ V GM+P K ++RL ++ P+ Sbjct: 80 HTGYPGGLKEILAKDLHRKDGTRILWRAVNGMLP-KNNLRPTWMKRLYLFEDEHHPY 135 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 31.1 bits (67), Expect = 0.70 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 54 SMAVVICWAVWRQSSPRSFSKGTKLLWFAANKSTSLATSLG 176 SM+V +C ++W + P F +L+W+ N S++ SLG Sbjct: 265 SMSVSLCQSIWYHTHPSVFVSLGQLIWY--NTHPSVSVSLG 303 >SB_2284| Best HMM Match : Hormone_5 (HMM E-Value=0.46) Length = 1266 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = +2 Query: 419 PGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVAYEKKLKRITKDAGEKVSKA 592 PG C VG+L H W + R L R+ + ++ A + + +G+ S++ Sbjct: 866 PGEQLCLVGQLGHRARWSSSVIDRPLHTGRRRDSARKAAAGGRTADQGERSGDSASRS 923 >SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +3 Query: 453 PMKLDGNTVMLFVSLKTRGRARLL--RELPMKRNLRGSPRMLVRR 581 P K +GNT V ++ GR + L R +P++ N G P+ LV+R Sbjct: 1114 PGKAEGNTDKRIVPVENNGRIKQLDKRIIPVENN--GRPKQLVKR 1156 >SB_51578| Best HMM Match : Hormone_5 (HMM E-Value=1.2) Length = 622 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 419 PGRNYCHVGRLSHEIGWKYRDVVRKLEDKRKGKAVKRVA 535 PG C VG+L H W + R L R+ + ++ A Sbjct: 407 PGEQLCLVGQLGHRARWSSSVIDRPLHTGRRRDSARKAA 445 >SB_39792| Best HMM Match : Usp (HMM E-Value=1.2e-14) Length = 271 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +2 Query: 410 CLKPGRNYCHVGRL---SHEIGWKYRDVVRKL--EDKRKGKAVKRVAYEKKLKRITKDAG 574 C KPG+++ HV + H ++ D R + + K A+K +Y KLK + +D G Sbjct: 106 CYKPGQDFLHVVHVLNRPHIFSSRHHDAYRAIIHDVNEKANALKD-SYISKLKALVQDEG 164 >SB_42005| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 621 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 270 HRILDGALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEMLICSQRTTT 127 H + AL+W+G R FTL + + + LS + K + + C ++T Sbjct: 530 HEVWYQALRWRGERVYFTLIMPWMSRVPLSQPIPKRSDRVSCGALSST 577 >SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) Length = 225 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -2 Query: 231 RAGFTLHLLRRNDISLSLFLKKLPEMLICSQRTTTTL 121 R G+ + + ++ ++ LFL PE++ R TT + Sbjct: 131 RGGYNCSVCKTSEAAMELFLNNQPEVIFIDMRDTTPI 167 >SB_11395| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-06) Length = 672 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 8 RFVV--KMTGFSNKAIVIDGRGHLLGRLAAVIAKVLLEGN 121 R+V+ + +G +NK ++IDG L A +V+++GN Sbjct: 601 RYVISGQHSGTTNKRVIIDGNDMLSPHSVATNKRVIIDGN 640 >SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2337 Score = 27.5 bits (58), Expect = 8.6 Identities = 22/87 (25%), Positives = 35/87 (40%), Gaps = 4/87 (4%) Frame = +2 Query: 113 EGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNVNPARG-PFHFRAPSKILWKTVRGM 289 +G+ V+ IN+ N ++ LR V R + + ++T+ + Sbjct: 837 QGHSTCKVKGLHINLRTGDIVNLTSMLELLRVEGAVAEERHVTLPYTIQRNVHYRTLHTV 896 Query: 290 IPHKTER---GKNALRRLRTYDGCPPP 361 HKT R K R +RTY PPP Sbjct: 897 PAHKTFRFVYNKRVRRGMRTYPYAPPP 923 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,060,483 Number of Sequences: 59808 Number of extensions: 397250 Number of successful extensions: 1744 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1742 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -