BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f07 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 275 2e-74 SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) 246 1e-65 SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) 194 5e-50 SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) 154 6e-38 SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) 85 6e-17 SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) 66 3e-11 SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) 31 0.56 SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) 31 0.74 SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) 29 2.2 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_1274| Best HMM Match : PARG_cat (HMM E-Value=2.5e-14) 27 9.1 SB_45865| Best HMM Match : Adeno_E4_34 (HMM E-Value=6) 27 9.1 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 275 bits (675), Expect = 2e-74 Identities = 126/161 (78%), Positives = 142/161 (88%) Frame = +3 Query: 129 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKA 308 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACET+ KTGM+LLCGEITS A Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMILLCGEITSNA 88 Query: 309 NVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQ 488 VDYQ VVR+ +K IGYDDS KGFDYKTC+V++AL+QQS +IA GVH R +E+VGAGDQ Sbjct: 89 VVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDIAHGVHVGREEEDVGAGDQ 148 Query: 489 GLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWWA 611 GLMFGYATDETEE MPLTVVLAHK+NQK+AE RR+G WA Sbjct: 149 GLMFGYATDETEELMPLTVVLAHKMNQKLAEYRRDGTLPWA 189 >SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 246 bits (601), Expect = 1e-65 Identities = 117/166 (70%), Positives = 130/166 (78%) Frame = +3 Query: 111 YDMEDGSVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCG 290 Y D FLFTSESV EGH DKMCDQISDA+LDAHL QDP AKVACET TKTG+VLL G Sbjct: 44 YSTSDCDNFLFTSESVNEGHSDKMCDQISDAVLDAHLEQDPYAKVACETATKTGLVLLFG 103 Query: 291 EITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEE 470 EITS A VDYQ VVR T++ IGY+DSS GFDYKTCSV+LA+ +Q IA VH NR D+E Sbjct: 104 EITSNARVDYQAVVRNTIRDIGYNDSSTGFDYKTCSVLLAIQEQVAEIAQTVHLNRRDDE 163 Query: 471 VGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWW 608 +GAGDQGLMFGYATDETEE MPLT VLAHKL ++AE R+ W Sbjct: 164 IGAGDQGLMFGYATDETEELMPLTTVLAHKLCARLAECRKGKILPW 209 >SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 194 bits (473), Expect = 5e-50 Identities = 85/118 (72%), Positives = 105/118 (88%) Frame = +3 Query: 255 TITKTGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNI 434 ++ KTGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSKGFDYKTC+V+ A++QQSP+I Sbjct: 2 SVAKTGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSKGFDYKTCTVLQAIEQQSPDI 61 Query: 435 AAGVHENRNDEEVGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWW 608 A GVH R+DE++GAGDQGLMFGYATDET+E MPLTVVLAH LN+++A+ RRNG W Sbjct: 62 AQGVHIGRSDEDLGAGDQGLMFGYATDETDELMPLTVVLAHGLNKRLADCRRNGSLPW 119 >SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 154 bits (373), Expect = 6e-38 Identities = 68/82 (82%), Positives = 77/82 (93%) Frame = +3 Query: 129 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKA 308 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACE++ KTGM+++CGEITS A Sbjct: 9 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACESVAKTGMIVVCGEITSLA 68 Query: 309 NVDYQKVVRETVKHIGYDDSSK 374 NVDYQKVVR+T+K IGYDDSSK Sbjct: 69 NVDYQKVVRDTIKQIGYDDSSK 90 >SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) Length = 70 Score = 84.6 bits (200), Expect = 6e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 129 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVAC 251 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVAC Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVAC 69 >SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) Length = 192 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = +3 Query: 465 EEVGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRNGEFWW 608 E+ GAGDQGLMFGYAT+ET+ MP V AH+L ++ +ELRRNG W Sbjct: 8 EDQGAGDQGLMFGYATNETDSLMPAPVYYAHRLVERQSELRRNGTLPW 55 >SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 13 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 147 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 416 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 461 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 33.5 bits (73), Expect = 0.14 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 13 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 147 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 70 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 115 >SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) Length = 390 Score = 31.5 bits (68), Expect = 0.56 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 288 GEITSKANVDYQKVVRETV---KHIGYDDSSKGFDYK 389 GEITS N+D +K+ + K I YD G+DY+ Sbjct: 103 GEITSNVNIDREKLPGSNLLEFKAIAYDAKGAGYDYR 139 >SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) Length = 681 Score = 31.1 bits (67), Expect = 0.74 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 510 LHNRTSSPGLLPQLPRHFCSHAPQQQCLVIVGL 412 L N T+ P + PQ P H SHA + ++I G+ Sbjct: 99 LGNETARPAIAPQEPEHLVSHANKILTVIIQGM 131 >SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) Length = 550 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 256 VSHATFASGS*FRCASRIASLIWSHILSG 170 +S + A + FRC+ R S++W H+ +G Sbjct: 287 ISDSDLAKVASFRCSGRFPSIVWRHMTNG 315 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 60 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 236 MP G +K N + D D +L +S+ + D++C + I AHL QDPD Sbjct: 196 MPYGGGKRGKSKKNSSTLDTGDLETWLKGRKSITRVRNHDELCAARALVIGMAHLTQDPD 255 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 5.2 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 60 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 236 MP + G +K N + D D +L S+ + D++C + I AHL +DPD Sbjct: 241 MPFGAGKRGKSKKNSSTLDTGDLETWLKGKRSITRVRNHDELCAARATVIGMAHLTKDPD 300 >SB_1274| Best HMM Match : PARG_cat (HMM E-Value=2.5e-14) Length = 334 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 471 LPRHFCSHAPQQQCLVIVGLVRASHCMSCNQSL-WTNHHN 355 L R FC +C+ I+G R S+ + W HH+ Sbjct: 106 LSRLFCERLDSNECVFIIGAQRFSNYTGYAHTFKWAGHHD 145 >SB_45865| Best HMM Match : Adeno_E4_34 (HMM E-Value=6) Length = 766 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 396 SVMLALDQQSPNIAAG-VHENRNDEEVGAGDQGLMFGYATDETEECMPLTVVLAHKLNQK 572 S +AL ++S + AAG + ++ G +M D+ EC P +++ A LN+K Sbjct: 613 SQAVALLRRSVHAAAGRLDDSHVMSSRGTHRVEIMLRLLPDDFAECSPDSLMFARALNEK 672 Query: 573 IAEL 584 I +L Sbjct: 673 IYKL 676 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,401,794 Number of Sequences: 59808 Number of extensions: 488308 Number of successful extensions: 1350 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1349 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -