BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f05 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyc... 27 1.8 SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 9.7 >SPBP8B7.27 |mug30||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 27.5 bits (58), Expect = 1.8 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -3 Query: 657 ETSLYLFFSWMKKHKGYDHYLVDYMXYYTSIHININIQL 541 E+S YL+F++ + K D+Y + + +IH +IN+ + Sbjct: 501 ESSNYLWFNYSHRSKEIDYYHMSGILMGIAIHNSINLDV 539 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 25.0 bits (52), Expect = 9.7 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 218 VHYLNNHLPKILGLHINLFSSQARSKTFAIFTKEKCTYFNIPILLIYK 361 ++Y+ LP +LG+ LFS S E+CT +P LL YK Sbjct: 810 MNYIMETLPHLLGIKEILFSVLELSSLLWKARTEECTDQYVPQLL-YK 856 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,371,084 Number of Sequences: 5004 Number of extensions: 42540 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -