BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f05 (659 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48621-7|CAA88546.1| 770|Caenorhabditis elegans Hypothetical pr... 29 2.9 U37429-9|AAA79344.3| 796|Caenorhabditis elegans Hypothetical pr... 29 3.9 >Z48621-7|CAA88546.1| 770|Caenorhabditis elegans Hypothetical protein R07B1.9 protein. Length = 770 Score = 29.1 bits (62), Expect = 2.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 48 WCRGTLDRNEVPYYKN 1 WC T+D N +P+YKN Sbjct: 263 WCLKTVDNNAMPFYKN 278 >U37429-9|AAA79344.3| 796|Caenorhabditis elegans Hypothetical protein F09E5.5 protein. Length = 796 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = +3 Query: 33 VSHDTTHLFFNLSPIQDDPPYFY---PS*FAFDIDEVISLAKKI 155 VSH+T + NL P +D+ YFY P+ + + ++LAK++ Sbjct: 407 VSHETHDWYKNLRPSEDNHGYFYTDLPNTVFGMLKDTVTLAKEV 450 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,758,824 Number of Sequences: 27780 Number of extensions: 228196 Number of successful extensions: 419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -