BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10f03 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40574| Best HMM Match : Dynein_light (HMM E-Value=0) 182 3e-46 SB_6167| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_33888| Best HMM Match : RhoGEF (HMM E-Value=1.6) 30 1.6 SB_26492| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_40574| Best HMM Match : Dynein_light (HMM E-Value=0) Length = 89 Score = 182 bits (442), Expect = 3e-46 Identities = 81/89 (91%), Positives = 87/89 (97%) Frame = +1 Query: 103 MCDRKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR 282 M +RKAVIKNADM+E+MQ DA++CATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR Sbjct: 1 MSERKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGR 60 Query: 283 NFGSYVTHETRHFIYFYLGQVAILLFKSG 369 NFGSYVTHET+HFIYFYLGQVAILLFKSG Sbjct: 61 NFGSYVTHETKHFIYFYLGQVAILLFKSG 89 >SB_6167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 72.9 bits (171), Expect = 2e-13 Identities = 30/80 (37%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = +1 Query: 121 VIKNADMSEEMQQDAVDCATQALEKFNIEKDIAA-FIKKEFDKKYNPTWHCIVGRNFGSY 297 +I+ +DM++EM+ +A++ A EKF+ + AA IK+ DKK+ +WH +VG FG Sbjct: 26 LIRYSDMNDEMRTEAMELCVTACEKFSNNNETAAKMIKESMDKKFGASWHAVVGEGFGFE 85 Query: 298 VTHETRHFIYFYLGQVAILL 357 +THE R+ +Y + G+ +L Sbjct: 86 ITHEVRNLLYMFFGKYTTIL 105 >SB_33888| Best HMM Match : RhoGEF (HMM E-Value=1.6) Length = 354 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 223 FIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFY 333 ++K+E D PT+ + G +G +T+HFIY Y Sbjct: 42 YVKREGDPLVRPTFP-VAGFTYGIQYAAKTKHFIYVY 77 >SB_26492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +1 Query: 439 ADSHARLGLWYIPIGS*QPECGRRRQG*CWCERFSSECESGC 564 AD + +GLW+ +G + C E+F EC+ C Sbjct: 308 ADVYYNIGLWFKSLGDNGQAMVNFKNALCIYEKFGEECKQAC 349 >SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 474 NVPQPEPRMRICKGYPSDNTASAANKKIEVMLNGLT 367 N P EP + + G P DNT ++ KI V NG + Sbjct: 7 NRPVHEP-LAVLSGVPKDNTIPSSAPKISVSKNGFS 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,916,350 Number of Sequences: 59808 Number of extensions: 418945 Number of successful extensions: 1015 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -