BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e23 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 25 0.78 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.78 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.78 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 1.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.4 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 5.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 5.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 5.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.2 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 7.2 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 7.2 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 7.2 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.6 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.6 bits (51), Expect = 0.78 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -2 Query: 435 TRHYLTVVN*EGYREYILSMVLESS 361 +++Y+T+++ G+R++I +M+ +S Sbjct: 10 SKYYVTIIDAPGHRDFIKNMITGTS 34 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.6 bits (51), Expect = 0.78 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -2 Query: 435 TRHYLTVVN*EGYREYILSMVLESS 361 +++Y+T+++ G+R++I +M+ +S Sbjct: 26 SKYYVTIIDAPGHRDFIKNMITGTS 50 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.78 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = -2 Query: 435 TRHYLTVVN*EGYREYILSMVLESS 361 +++Y+T+++ G+R++I +M+ +S Sbjct: 83 SKYYVTIIDAPGHRDFIKNMITGTS 107 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 1.0 Identities = 7/24 (29%), Positives = 19/24 (79%) Frame = -2 Query: 432 RHYLTVVN*EGYREYILSMVLESS 361 ++Y+T+++ G+R++I +M+ +S Sbjct: 84 KYYVTIIDAPGHRDFIKNMITGTS 107 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 501 WTQRLGVMCQILTQSCQPHYCI-LW 572 W+ LG +C + + C P Y I +W Sbjct: 527 WSHVLGWLCGLSSMLCIPGYMIYIW 551 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +3 Query: 501 WTQRLGVMCQILTQSCQPHYCI-LW 572 W+ LG +C + + C P Y I +W Sbjct: 580 WSHVLGWLCGLSSMLCIPGYMIYIW 604 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 157 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDV 273 I+SS +KT+ +K + NNY K+LY + ++I + Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQI 122 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 157 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDV 273 I+SS +KT+ +K + NNY K+LY + ++I + Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQI 122 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 157 ILSSSRDKTLIV---WKLTRDENNYGIPQKRLYGHSHFISDV 273 I+SS +KT+ +K + NNY K+LY + ++I + Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNNNYNNNCKKLYYNINYIEQI 122 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 532 FSPNHANPIIVSCGWDRTVK 591 F NPI V WD+ V+ Sbjct: 323 FDRMQGNPICVQIPWDKNVE 342 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -3 Query: 497 SWMVYLHSARVFQSLIVLSREPDTI*RLSTEKATESTSLVW 375 SW + +F L++L+ +++ LS + ST+L W Sbjct: 2 SWQRVFLAVGLFGVLLLLTNADNSVHILSKYQLITSTTLNW 42 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 518 CHVSDSHPIMPTPLL 562 CH D++ ++ TP L Sbjct: 463 CHADDAYMVVDTPFL 477 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 7.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 518 CHVSDSHPIMPTPLL 562 CH D++ ++ TP L Sbjct: 463 CHADDAYMVVDTPFL 477 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 494 WMVYLHSARVFQSLIVLSRE 435 W++YLH + V +VL E Sbjct: 424 WIIYLHISDVVADDLVLLEE 443 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 494 WMVYLHSARVFQSLIVLSRE 435 W++YLH + V +VL E Sbjct: 424 WIIYLHISDVVADDLVLLEE 443 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 473 ARVFQSLIVLSREPDTI*RLSTEKAT 396 A + Q+L L R PDT+ +++ + T Sbjct: 886 ANLTQTLDKLIRSPDTLRKIAQNRGT 911 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,801 Number of Sequences: 438 Number of extensions: 4219 Number of successful extensions: 21 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -