BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e22 (569 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118774-1|AAM50634.1| 189|Drosophila melanogaster GH11730p pro... 29 5.8 AE014296-3679|AAF51834.1| 189|Drosophila melanogaster CG11404-P... 29 5.8 >AY118774-1|AAM50634.1| 189|Drosophila melanogaster GH11730p protein. Length = 189 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/50 (24%), Positives = 29/50 (58%) Frame = +1 Query: 358 VIMKLKKEVDINHGDSVVWKNIEMASGPNSPVQTEQDIEDIFGDSLKTWD 507 + M++ + ++++ + +W+NI + +P+Q E + FG+S+ WD Sbjct: 19 ISMEINRIINVSTAQTSLWQNIPIIGQMFAPLQPETNYGVEFGESM--WD 66 >AE014296-3679|AAF51834.1| 189|Drosophila melanogaster CG11404-PA protein. Length = 189 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/50 (24%), Positives = 29/50 (58%) Frame = +1 Query: 358 VIMKLKKEVDINHGDSVVWKNIEMASGPNSPVQTEQDIEDIFGDSLKTWD 507 + M++ + ++++ + +W+NI + +P+Q E + FG+S+ WD Sbjct: 19 ISMEINRIINVSTAQTSLWQNIPIIGQMFAPLQPETNYGVEFGESM--WD 66 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.313 0.128 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,830,871 Number of Sequences: 53049 Number of extensions: 363198 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2234671092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -