BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e22 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 24 0.92 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 3.7 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 4.9 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 22 4.9 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 22 4.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.6 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 24.2 bits (50), Expect = 0.92 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 343 SPVYSV-IMKLKKEVDINHGDSVVWKNIEM 429 S +YSV ++ L K +++NH + V N+E+ Sbjct: 301 SKLYSVSVVSLDKSLEVNHISARVGDNVEI 330 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 3.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +3 Query: 123 PSGLCRTADPSAETKTTQANLEQEE 197 P G+C T D +T +T+ L++ + Sbjct: 367 PPGVCYTCDVCGKTLSTKLTLKRHK 391 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 92 NNTVRMTSFNTLWTMSNSRSISRN 163 NN N LWT ++++ IS N Sbjct: 289 NNVHYQGKENILWTQASAKGISDN 312 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 349 VYSVIMKLKKEVDINHGDSVVWK 417 V SV+ KKEV G V W+ Sbjct: 108 VESVVETCKKEVTSTEGCEVAWQ 130 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 349 VYSVIMKLKKEVDINHGDSVVWK 417 V SV+ KKEV G V W+ Sbjct: 82 VESVVETCKKEVTSTEGCEVAWQ 104 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/57 (19%), Positives = 21/57 (36%) Frame = -3 Query: 534 IFLCIVSEMIPRL*GVTEXXXXXXXXXNRRVRAGGHFYILPNDGIAVIDINFFLEFH 364 + C+V + L V ++ G F++LP + V + F + H Sbjct: 149 VLRCVVPSFVKDLVRVVSWLQEPSFYIYPSLQGDGKFHLLPTGELLVHSLEFSDQIH 205 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/57 (19%), Positives = 21/57 (36%) Frame = -3 Query: 534 IFLCIVSEMIPRL*GVTEXXXXXXXXXNRRVRAGGHFYILPNDGIAVIDINFFLEFH 364 + C+V + L V ++ G F++LP + V + F + H Sbjct: 149 VLRCVVPSFVKDLVRVVSWLQEPSFYIYPSLQGDGKFHLLPTGELLVHSLEFSDQIH 205 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 427 MASGPNSPVQTEQDIEDIFGDS 492 M P+ + Q++++IFGDS Sbjct: 364 MGCHPDIQEKVIQELDEIFGDS 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.313 0.128 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,967 Number of Sequences: 438 Number of extensions: 2135 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -