BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e22 (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g14710.1 68415.m01654 F-box family protein contains Pfam prof... 31 0.72 At5g28160.1 68418.m03403 kelch repeat-containing F-box family pr... 29 1.7 At4g37110.1 68417.m05256 expressed protein 29 2.2 At3g63200.1 68416.m07100 patatin-related low similarity to patat... 29 2.9 At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zi... 27 8.8 At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zi... 27 8.8 At1g27850.1 68414.m03413 expressed protein similar to En/Spm-lik... 27 8.8 >At2g14710.1 68415.m01654 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 362 Score = 30.7 bits (66), Expect = 0.72 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 319 DKMNVKHHSPVYSVIMKLKKEVDINH--GDSVVWKNIEMASGPNSP 450 D+ ++ V I E INH GD VVWKN S PN P Sbjct: 236 DRFSLLKQCMVTKKIEVFVTENKINHENGDDVVWKNFMTFSSPNLP 281 >At5g28160.1 68418.m03403 kelch repeat-containing F-box family protein low similarity to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 324 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 319 DKMNVKHHSPVYSVIMKLKKEVDINHGDSVVWKNIEMA 432 DK+++ H ++ ++ L+K HG VW NIE A Sbjct: 271 DKVDLSHDKDIWCAVIALEKR----HGSDEVWGNIEWA 304 >At4g37110.1 68417.m05256 expressed protein Length = 417 Score = 29.1 bits (62), Expect = 2.2 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +1 Query: 331 VKHHSPV-YSVIMKLKKEVDINHGDSVVWKNIEMASGPNSPVQTEQDIEDIFGDSLKTWD 507 +K+ +PV Y+ +LKK ++ + V+W + G + TE+ E + G++ +TW+ Sbjct: 108 LKNATPVSYAEEPELKKG-KVSKEEIVLW----VGEGVRPEIYTEEH-EKLLGNTERTWE 161 Query: 508 HFTDDAKKN 534 F D KN Sbjct: 162 LFVDGCDKN 170 >At3g63200.1 68416.m07100 patatin-related low similarity to patatin-like latex protein allergen Hev b 7 - Hevea brasiliensis, EMBL:AF113546; contains patatin domain PF01734 Length = 384 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +3 Query: 12 CWQHEDYIRI---AVSDAGAEHLLQHLHDETTQSG 107 CW DY+RI ++ GAE LL+ ET G Sbjct: 305 CWNRTDYVRIQANGLTSGGAEELLKERGVETAPFG 339 >At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 647 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 460 EQDIEDIFGDSLKTWDHFTDDAKKNTFHDAISEN 561 +QD+ED + L+ W+H+ D+ + F EN Sbjct: 531 QQDVEDRAVEVLQLWEHYLKDSDWHPFKRVKLEN 564 >At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 647 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 460 EQDIEDIFGDSLKTWDHFTDDAKKNTFHDAISEN 561 +QD+ED + L+ W+H+ D+ + F EN Sbjct: 531 QQDVEDRAVEVLQLWEHYLKDSDWHPFKRVKLEN 564 >At1g27850.1 68414.m03413 expressed protein similar to En/Spm-like transposon protein GB:AAB95292 GI:2088658 from [Arabidopsis thaliana] Length = 1148 Score = 27.1 bits (57), Expect = 8.8 Identities = 15/70 (21%), Positives = 34/70 (48%) Frame = +1 Query: 307 KQVHDKMNVKHHSPVYSVIMKLKKEVDINHGDSVVWKNIEMASGPNSPVQTEQDIEDIFG 486 +++ K + + HS Y ++ + K + D ++ ++ + +Q+ D+ED+F Sbjct: 13 RELPGKKHRRGHSIEYGILFRDKDD------DLALFSEMQDKERDSFLLQSSDDLEDVFS 66 Query: 487 DSLKTWDHFT 516 LK + FT Sbjct: 67 TKLKHFSEFT 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.313 0.128 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,917,388 Number of Sequences: 28952 Number of extensions: 165674 Number of successful extensions: 373 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -