BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e20 (510 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 9e-23 SB_43135| Best HMM Match : CMAS (HMM E-Value=0) 36 0.015 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_86| Best HMM Match : PGK (HMM E-Value=0) 27 9.0 SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) 27 9.0 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 103 bits (247), Expect = 9e-23 Identities = 54/112 (48%), Positives = 66/112 (58%) Frame = +1 Query: 82 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 261 M S +ELACVYSALIL DDDVA+T +KI T++KAA ++VEP+WPGLFAKAL+G N+ DLI Sbjct: 1 MASTSELACVYSALILHDDDVAITADKIETLVKAAKINVEPFWPGLFAKALQGHNIADLI 60 Query: 262 TNIGSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFGLFD 417 + +G SDDDMGFGLFD Sbjct: 61 --LSAGAPGAGGAVAAAPAAGGEAKAEEKKEEAKKEESEEESDDDMGFGLFD 110 >SB_43135| Best HMM Match : CMAS (HMM E-Value=0) Length = 254 Score = 36.3 bits (80), Expect = 0.015 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 261 DQVTDIDAFQGFGEQTWPIWLYIYSRRFQDGGNFLTSYGNIIINQDESR 115 DQ+ I+ F+ G++ WP + + S R + GG+ + II DESR Sbjct: 102 DQIVSIEMFEAVGQENWPTYFQMLSERLKQGGSAVLQ----IICIDESR 146 >SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 762 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SDDDMGFGLFD Sbjct: 752 SDDDMGFGLFD 762 >SB_58926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2371 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 270 DVGDQVTDIDAFQGFGEQTWPIWLYIYSRRFQDGGNFLTSY 148 D+G +VT + G T W+ +YS D G+F T Y Sbjct: 2100 DLG-RVTRVTGIATQGSPTGDKWVKLYSVEQSDDGHFFTEY 2139 >SB_86| Best HMM Match : PGK (HMM E-Value=0) Length = 445 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 187 PPLSRWWKFSHQLRQHHHQ 131 PP RWW++ H LRQ H+ Sbjct: 394 PP--RWWRYRHVLRQMGHR 410 >SB_51986| Best HMM Match : HLH (HMM E-Value=0.15) Length = 2110 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 266 LVIRSRTLMPSKA-LANRPGQYGSTSTAAAFKMVEIFSPVTATSSSTRMRAE*TH 105 L++ S + P ++ LA PGQ G+T+T F+ PV S+ + TH Sbjct: 1763 LIVPSPAIAPVQSQLATTPGQVGNTNT--LFRPASTMVPVQPAVSNETLHPAVTH 1815 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,045,325 Number of Sequences: 59808 Number of extensions: 193829 Number of successful extensions: 467 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -