BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e18 (671 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 3.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 3.5 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 3.5 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 22 4.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.6 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 6.1 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 6.1 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.1 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -1 Query: 182 NVLNSLCNFFEMKFHIIKCRFGINQNLYGINNNPKIVLIQFIGKF 48 NV +C+ + ++F + ++GI QN +I ++ G F Sbjct: 48 NVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMF 92 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 396 TRNTLYFNTIYSNY*NHQKYYS 461 + T++ N Y+NY N + YY+ Sbjct: 308 SNKTIHNNNNYNNYNNKKLYYN 329 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 3.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 384 SYNSTRNTLYFNTIYSNY*NHQKYYSTWNFSST 482 +Y+S NTL + + SN + K+ + N SST Sbjct: 300 AYSSLENTLKYYEVGSNVPFNFKFITDANSSST 332 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 545 LVPVLLNNVINKCPAIMLAVNRT 477 L+P +LNN N+C + + + T Sbjct: 56 LLPEVLNNHCNRCTSRQIGIANT 78 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 366 YKSHIYSYNSTRNTLYFNTIYSNY*NHQK--YYSTWN 470 + ++ Y YN N N +NY N+ K YY+ N Sbjct: 324 HNNNNYKYNYNNNNYNNNNYNNNYNNNCKKLYYNIIN 360 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 357 N*KYKSHIYSYNSTRNTLYFNTIYSNY*NHQKYY 458 N KY S+ +YN+ N Y N +NY K Y Sbjct: 88 NYKY-SNYNNYNNNYNNNYNNNYNNNYKKLYKNY 120 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 357 N*KYKSHIYSYNSTRNTLYFNTIYSNY*NHQKYY 458 N KY S+ +YN+ N Y N +NY K Y Sbjct: 88 NYKY-SNYNNYNNNYNNNYNNNYNNNYKKLYKNY 120 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 384 SYNSTRNTLYFNTIYSNY 437 S+ T N YF+ Y NY Sbjct: 209 SWRITHNFFYFDPRYGNY 226 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,400 Number of Sequences: 438 Number of extensions: 2125 Number of successful extensions: 21 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -