BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e15 (686 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.15c |||ubiquitin-protein ligase E3 RBBP6 family |Schizos... 27 1.9 SPAC3F10.03 |||glycine tRNA-ligase|Schizosaccharomyces pombe|chr... 26 5.9 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 26 5.9 SPBC1289.08 |||UDP-N-acetylglucosamine diphosphorylase |Schizosa... 25 7.8 SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 25 7.8 >SPBP8B7.15c |||ubiquitin-protein ligase E3 RBBP6 family |Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 27.5 bits (58), Expect = 1.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 560 GFRCPRCGATGDRAHTIKYCPQNSD 634 G+ C RCG G H I+ CP N+D Sbjct: 182 GYICYRCGQKG---HWIQACPTNAD 203 >SPAC3F10.03 |||glycine tRNA-ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 652 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 341 KKIVSMHETALLSLTPDQYQFLLIYVEALRQKRIG-LQKHFECAFCKKNGE 490 KK+ + T L T ++Y+F+L ++ ++G L K ++ NGE Sbjct: 143 KKVKEIRATRLDDKTVEEYEFILAQIDNYDGDQLGELMKKYDIRNPATNGE 193 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 25.8 bits (54), Expect = 5.9 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 273 SVPSIFLVSTVICASKTAGSSFTACKASFFKMHPLSKNS 157 S P+I L STV+ T +SFT S K L+ NS Sbjct: 3821 SNPNI-LSSTVLSFDSTITNSFTTASTSIMKTTSLNSNS 3858 >SPBC1289.08 |||UDP-N-acetylglucosamine diphosphorylase |Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 497 SWYRTHALKDGRGRVKCPVLRGFRCPRCGATGDR 598 SW+RT + RG V VL G + R G G + Sbjct: 84 SWWRTGLREIARGHVAALVLAGGQGTRLGFAGPK 117 >SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 25.4 bits (53), Expect = 7.8 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +2 Query: 371 LLSLTPDQYQFLLIYVEALRQKRIGLQKHFECAFCKKNGESVSWY 505 L+ + +Y LI V +LRQ R+ + F + NG SVS+Y Sbjct: 337 LVGTSSTRYNEALIDV-SLRQSRMSRRLGFTLRHMRINGSSVSFY 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,038,282 Number of Sequences: 5004 Number of extensions: 66640 Number of successful extensions: 202 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -