BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e13 (526 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0128 + 13195958-13196011,13196399-13196407,13197257-131973... 28 5.3 03_03_0097 + 14386262-14386532,14387696-14387919,14388057-143883... 28 5.3 >10_07_0128 + 13195958-13196011,13196399-13196407,13197257-13197337, 13197375-13197856,13198287-13198323,13198425-13198529 Length = 255 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 205 EDNERYFSPDLLHVVRIATISNLELAPYGIRSVPTKTE 318 +DNE + LH R+ +S L++ PY + V E Sbjct: 11 QDNENGYQARKLHYYRMIALSPLDIPPYNLLPVDVMLE 48 >03_03_0097 + 14386262-14386532,14387696-14387919,14388057-14388307, 14388393-14388771,14388958-14389389 Length = 518 Score = 27.9 bits (59), Expect = 5.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 196 NDEEDNERYFSPDLLHVVRIATISNLELAPYGIRSVPTK 312 N E+ E + + L + IATI NL+L G + +PTK Sbjct: 218 NSEKGKEVFHAQKQLQAIAIATILNLQLP--GFKYLPTK 254 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,587,962 Number of Sequences: 37544 Number of extensions: 231395 Number of successful extensions: 370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -