BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e13 (526 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094824-1|AAM11177.1| 604|Drosophila melanogaster LD37241p pro... 28 8.9 AE014296-3742|AAF51882.1| 604|Drosophila melanogaster CG11128-P... 28 8.9 AE014296-3741|AAF51880.1| 604|Drosophila melanogaster CG11128-P... 28 8.9 AE014296-3740|AAF51881.1| 604|Drosophila melanogaster CG11128-P... 28 8.9 >AY094824-1|AAM11177.1| 604|Drosophila melanogaster LD37241p protein. Length = 604 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 398 GFYIITVQ-SFTLGGKLVT*SFLIGIPSSVFVGTLLIPYGA 279 G Y++ Q +F + G VT SFLI +S F G + A Sbjct: 44 GVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAA 84 >AE014296-3742|AAF51882.1| 604|Drosophila melanogaster CG11128-PC, isoform C protein. Length = 604 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 398 GFYIITVQ-SFTLGGKLVT*SFLIGIPSSVFVGTLLIPYGA 279 G Y++ Q +F + G VT SFLI +S F G + A Sbjct: 44 GVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAA 84 >AE014296-3741|AAF51880.1| 604|Drosophila melanogaster CG11128-PB, isoform B protein. Length = 604 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 398 GFYIITVQ-SFTLGGKLVT*SFLIGIPSSVFVGTLLIPYGA 279 G Y++ Q +F + G VT SFLI +S F G + A Sbjct: 44 GVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAA 84 >AE014296-3740|AAF51881.1| 604|Drosophila melanogaster CG11128-PA, isoform A protein. Length = 604 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 398 GFYIITVQ-SFTLGGKLVT*SFLIGIPSSVFVGTLLIPYGA 279 G Y++ Q +F + G VT SFLI +S F G + A Sbjct: 44 GVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAA 84 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,171,012 Number of Sequences: 53049 Number of extensions: 428522 Number of successful extensions: 722 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1949978112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -