BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10e03 (581 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 24 3.1 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 24 3.1 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 24.2 bits (50), Expect = 3.1 Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -2 Query: 382 QNTSIIYKHIQLVIVINSFFYYILDIALIIH-ISHDYQRFYFTGRLTFTIGCNII 221 + +I+Y + LV VI YYI+ + I+ + ++ G F CN++ Sbjct: 41 ERQTILYYDLPLVYVIIIAIYYIITLVAIMRAVVRQFKDRIAEGEGLFYQYCNLV 95 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 87 NSFHSFVKLRDKFITSKEPLG 25 N HSF LRD+ + P+G Sbjct: 625 NDSHSFCGLRDQLYPDRRPMG 645 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,958 Number of Sequences: 2352 Number of extensions: 13042 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -