BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10d21 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 27 8.7 SB_47669| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_25975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = -3 Query: 587 TILLYFNKLKNIVIYVFTNADDIFERYHIKVC*QDSCLKKSIFCKHNNIHIV 432 TI+ + K + + + F DI+ R + + C K+ F KH NI + Sbjct: 29 TIVSFIGKAETVFSFWFETRRDIYSRRRLPEGNVELCTGKAAFVKHYNISAI 80 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 474 QARILLTYFNMISFEYVICICKNVYYN 554 Q +LL+ N S++ VIC C N++ N Sbjct: 103 QKSLLLSLSNPDSYQVVICSCTNIHRN 129 >SB_47669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/27 (33%), Positives = 20/27 (74%) Frame = +3 Query: 432 YNMYIVVFAENRFFQARILLTYFNMIS 512 YN+YI++ E+ + Q ++L+ Y+ ++S Sbjct: 666 YNIYIIILYESIYSQYQLLICYYIILS 692 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,092,774 Number of Sequences: 59808 Number of extensions: 262451 Number of successful extensions: 658 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -